Loading...
HomeMy WebLinkAboutCCAgenda_88Sep28s enL. ~ ilicy % ITEM DESCRIPTION: CITY OF FALCON HEIGHTS REQUEST FOR COUNCIL CON8IDERATION Coffman Street Parking Meetins~ Date : F-1 Ag411dA Item: 9/28/88 SUBMITTED BY: Ail2iam A.~Madden, Chair, Ad Hoc Parking Committee, 1666 Coffman REVIEWED BY: Planning Commission EXPLANATION/SUMMARY (attach additional sheets as necessary): At the September 12th meeting of the Planning Commission, they discussed the request and recommended a parking permit system on Coffman from Larpenteur to the 1666 Coffman Fire Lane (see attached Minutes). Attachments: (a) Request from the 1666 Coffman Ad Hoc Parking Committee b) Planning Commission Minutes of September 12,.1988 c) November 14, 1984 Council Minutes granting parking variance for the Coffman Project (from required 2-1/2 spaces per unit to 1-1/2 spaces per unit) d) Miscellaneous correspondence and Minutes relating to parking problems in the Grove area. e) Information from City of St. Paul regarding resident parking permits 1~ i 4y ~ (~`~ w ACTION REQUESTED: Approval/disapproval 6/29/87 ATTACHMENT A -1 Y ~ I 1 166b Coffman, X119 lalcon Beights, MN 55108 6eptember 1, 1988 David Black, Chair Falcon Heights Planning Commission Falcon Heights City Ball 2077 Larpenteur Ave. Falcon Heights, MN 55113 Dear Mr. Black: Attached is the additional information requested at its last meeting by she Planning Commission concerning the proposed parking restriction on the east side of Coffman Street. Ne would appreciate this item being put on the Commission's agenda for discussion and actf on at its September 12 meeting. Several of us will be present to try to answer any questions members of the Corranission might have. Since the fall term begins shortly on the St. Paul campus, we earnestly hope that the Planning Commission will recommend approval for action of the proposal to the Falcon Heights City Council at the City Council's next regular meeting. We thank you and the other Conunission members for your continued interest in and work on this matter, which is important to Coffman residents. If you have questions regarding any of the material attached, please call me (644-9544). Sincerely yours, William A. 1Kadden Chair, Ad Hoc Parking Committee 1666 Cof fm-an LJ ATTACHMENT A-2 r , Addendum to September 1, 1988, letter to David Black,. Chair, lalcon Aeights Planning Caamiasion A. data requested: 1. 2. ~ Parking available on Co~fYman~ property. There are 94 units and 148 residents in 1666 Coffman. There are. 103 parking stalls in the garage (roughly one space per unit) and 41 outdoor parking places in front of Coffman (3 of which are reserved for handi- capped drivers). Six residents do not drive and therefore have no need for a parking place: they have rented their garage stalls to other residents. Pifty- nine residents have two cars tor, in some cases, one aar and one camper). Thus, the existing ca-property parking available is being used to its full capacity. Many of us frequently have visits from family members in the area. In addition, Coffman is used fairly regularly for wedding receptions, lectures, music recitals, and other semi-public functions which sub- stantially increase traffic flow. Repairmen and delivery men require parking space from time to time. with 140 spaces for approximately 165 vehicles, we urgently need (as do most home owners some off- proFerty parking space, which east Coffman Street would provide. 3. Rationale. As the. attached map makes clear, the propose par ing arrangement would fit well into the parking restrictions now in effect in the adjacent Grove areas. The space on east Coffman Street is currently the only unrestricted parking space available in the area, and hence it fills quite rapidly each weekday morning with students' cars, the space remaining occupied until about 4:00 pm. If agproved, the proposal would eliminate only 12 parking spaces, and hence would have a minor impact on students, who have mmple parking space nn:~ca~npns at a modest cost. iTe live here year round, permanently, whereas students are inevitably transients= it would be a serious and permanent inconvenience to Coffman residents to have this parking apace remain in its present unrestricted status. ddendum to September 1, 1988, letter to David Slack, Chair, !'aloon Heights Planning Cadnission Paqe Z 8. Psvposal That parking along the •ast side of Coffman Street, from Larpenteur south to the service road to the Faloon Heights Recreation Area (i.e., along the vest boundary of our propertyf be established as follows 1-hour/8 a.m.-4 p.m. / lrbnday thru !'riday / Except by permit" ArTTACHMENT A-3 r , ATTACHMENT A-4 i - - ~--~--~---Lr,~1.A!?A_..(~~' is..tko.. ~?.oL!~:~east.. of lbbb)_ 0 x ° i D ~ 3 N n A AC7tx+'J'~JC7H yy]]y'r+ y r `ma'y H ~ z 12 parkin- suaces t'_J15 carss~aces _ CG= i~1~;k~ bus ro~ite COFFN.A2ti no parkin~- o. 0 4 N ; c~ ~ i N w1 jo b o oc -~o y no parking r' n n n c c CL~~/LLAh'D -i i f ~~o parking ~' i ,. • '~t.., no park r-~ ~ a I q~ ~ o of ~ ~ ~' f ' .. ~'i~ ii , m j mb~ m ~ c+i ~ ~ ~ m ~ `J • tD m 1~' i O 'I c: ~ ; io ! ~ m! ~, f no par'rin~ ~f N i ~, Nt y i ~ , ' ~'ti ~ io m N ~ ±~ a a( a, 7' ~~o ~.. f ~ti b ' t. b i r ~ ~ . m s "' f ~ ~~' N ~ t ~ ~~ ~ y ~ i . t i I E''6 C'~QLIP . ATTACHMENT B -1 T ~ r ~ J MINUTES REGULAR PLAANhNG COMMISSI03~ MEETING SEPTEMBER 12, 1986 Chairman Black called•the meeting to order at 7:30 P.H. Black, Barry, Duncan, Neatingen, Carroll and Daykin. Couacil Liaison PRESENT Wa111n Was also present. Finegan, Grittner and Boche. ABSENT Barry moved, seconded by Daykin, approval of the August 1, 1968, and August 8/1 b 8/22 22, 1988, Planning Commission Minutes as presented. Motion carried MINUTES uaanimously. APPROVED Chairman Black briefly r~aritvrd the request by William A. Madden, Chair WILLIAM A. Ad Hoc Parking Committee for 1666 Coffman conceraing the proposed parkiag MADDEN, restriction on the east side of Coffman Street as well as background 1666 information. CO~p,N ~ PARKING Mr. Madden informed that he contacted both the state of Minnesota and Ramsey REQUEST County concerning the legality of parking permits and he was told that Falcon Heights has jurisdiction over their own streets and can issue whatever permits they wish. He then reviewed how the cite of St. Paul regulates parking in five areas of the city (resident permits, visitor's permits and special permits), costs and qualifications. Madden is concerned that 1666 Coffman residents are not being allowed to park on Coffman--University of Minnesota students are not Falcon Heights residents. He asked that the request be quickly acted upon. Discussion focused on whether visitor permits should be issued or whether resident permits should be issued or a combination of both, the precedent that will be set by allowing residents exclusive use of city streets and how such permits would be administered. Planner Malloy pointed out thatia MALLOY the November 5, 1984 Couacil Meeting Minutes Sohn Doan, City Planner, pointed out that space is available should it ever be needed for added parkiag at the 1666 Coffman site. A member of the University Grove Homeowner's Association advised that residents in that area will also be requesting resident parking permits soon similar to GROVE those issued by the city of St. Paul. ASSN. After further discussion, Duncan moved, seconded by Nestingea, to restrict MOTION FOR parking on Coffman from Larpenteur to Folwell to two hour parking from 8:00 A.M. 2 HR. to 4:00 P.M. weekdays and permits be issued for special events only. Upon a PARKING voice vote being taken, the following voted in favor thereof: Barry, Duncan FAILS and hestingen, and the follo~.-ing voted against the same: Black, Carroll and Davkin. Motion failed. Discussion continued concerning the possibility of additional parking being available on the 1666 Coffman site, permit parking for residents vs. permit S parkin€ for visitors, inexpensive parking being available for University students on Minnesota State Fair propert~~ and ho~:enfc:~.enentwould be handled. a ATTACHMENT B-2 MINUTES PLANNING COMMISSION MEETING SEPTEMBER 12, 1988 Planner Malloy pointed out that restricting student parking on Coffman will MALLOY migrate student parking to other areas. Daykin moved, seconded by Carroll, to allow twelve (12) parking permits on PARKING Coffman Street from Larpenteur to the 1666 Coffman Fire Lane for Sx~c PERMITS to be administered by City Staff for oae (1) hour parking from 8:00 A.M. ON COFFMAN to 4:00 P.M. Monday thru Friday (except holidays and except by permit) for STREET a six month trial period. Upon a voice vote being taken, the following APPROVED voted in favor thereof: Barry, Nestingen, Black, Carroll, Daykin and the following voted against the same: Duacan. Notion carried. Nestingen moved, seconded by Daykin, a reco®endation to the City Couacil REQUEST that the City authorize a proposal for a parking policy including permit FOR parking and parking in other cities. Motion carried unanimously. PARKING POLICY Planner Malloy then reviewed the Procedural Manual for the Planning Process and suggested the direction which should be followed for the development of PROCEDURE such manual. ~~~, Meeting adjourned at 10:20 P.*:. ADJOLTR2~'iEfi' Submitted by: Katherine J. Zimmerman APPROVED: October 3, 1988 Edgar Finegan, Secretary. ATTACHMENT .C -1 MINUTES/PUBLIC HEARING REGULAR CITY COUNCIL MEETING 1QOVEMBER 14, 1984 AGE 4 C' that if the Lido should .be located elsewhere and the present property sold,it ~rould be an unknown quantity. Councilmember Ciernia stated that if a committee is forced the members ofthecommittee, City Planner and Council should look at all options, notlooktoexclude•the project. After the options have been explored, Councilcouldthenconsiderthematter. The other Couacilmembers concurred. TheLabalestrasindicatedtheirwillingnesstoworkwiththegroup, Mayor'Eggert moved, seconded by Couacilmember Ciernia, that the hearing becontinuedto7:15 P.M., January 9, 1985. Motion carried unaniaously. Mayor Eggert then requested volunteers to serve on 'the neighborhoodcommitteeandthefollowingpersonsresponded: Halt McCoy, 1746 St. Marys,Florence Funk, 1628 Maple Knoll, Joy W. Jones, 1735 St. Mary's, Dennis Smith,1725 St. Mary's, Bod VonDeLind~,1734 St. Mary's, Ted •Peter pavtzeny, 1720 St. Ma • ~y~'• 1710 St. Mary s, Juntunan, 1728 St. Ma ~' s, Lolita Beck, 1766 St. Mary's, iiilliamry's, Jim Bykowski, 1745 St. •1713 St. Mary's. Councilmember Ciernia recommendedd tbat~the char~r ofZtbe~~group be to attempt to accommodate the Lido expansion with the progress reporttwomeetingsfromthisdate (December 12). Mayor Eggert moved, seconded by Councilmember Baldwin, that all of theresidentswhovolunteeredbeappointedtoacitizenscoamiittee. Motioncarriedunanimously. Mr. Labalestra indicated that they have a verbal comaitment on theirfinancing, but with the postponement that may change. Be stressed theimportanceofproceedingasquicklyaspossible. i ~~` LIDO coast . ) COUNC~LMEM- BER CIERNLA HEARING CONTINUED TO 9/9/85 CITIZENS COI~IITTEE APPOINTED COND. USE REFERRED PLANNING Jim Bykowski, 1745 St. Ma COMMISSION found which will allow the Lidostotexpandtwithopu~t deltraimeatuto the neighborhood. JIM BYROWSRI, Mayor Eggert moved, seconded by Coimcilmember Ciernia, that the public Hearing MARY'ST•on Tax Increment Financing Plan for Economic Development District No. 2 becontinuedto8:30 P.M., January 9, 1985. Motion carried unanimously. TIF HEARING Item 5c, concerning eminent domain g ry CONTINUED 9, 1985 meeting. proceedin s was deferred to the Janua TO 9/9/84 Attorney Gasteazoro advised. that due to the change from a rezoning requesttoaconditionaluserequest, it will be necessary that the matter be referredbacktothePlanningCommission. EMINENT Councilmember Chestovich presented variance re uests DOMAIb of Minnesota_Retirees. q the University DEFERRED a ~-~411nws, a ~' ~ ~n'#s~c ecarsperdwellingunit -~0 1~ tars -per trait, -~ density variance ~_from 12 dwelling units per acre to 16 per acre, and (3) height variance ~ EfiSfrom30feettoaccommodateapitchroof. The side lot set backpreviouslyrequestedhasbeendeleted, variance ~ V,i18~AtiC£S Gertrude £steros, Director of the Board, explained that the structure will 'be•three stories but with additional height to~accommidate the pitch roof 1''RNUTES/PUBLIC HEARING REGULAR CITY COUNCIL MEETING November 14, 1984 PAGE S a variance is necessary. Ir tip, The following persons were in attendance representing Eradford Schools: Brad Lemberg and Bob Russek, Bonestroo and Associates, Chria Seigle,Bradford Schools, and Steve Kinzer, President of the ~eapolis Business College. Mr. Russek reviewed the site plan, ezplafaed the parking, access roads, drainage, etc. Mr. Lemberg informed Council that sore completeplanswillbeavailablefortheDecember12thmeeting. Couacilmember Cieraia requested that Council consider the following conditions before approving the conditional use request: (1) If the students place extra- ordinary use on the City park should the school provide recreational facilities? (2) If on-campus parking proves to be inadequate, then program adjustments will be made or more parking provided, (3) A current copy of rules and regulations will be kept on file at the City Office, (4)Bradford Schools will designate an official community affairs representative. Attorney Gasteazoro was not sure of the legality of gutting conditions on a conditional use, but there could be a "gentleman's agreement". Mr. Seigleassuredthattherewillbeampleparkingprovidedatalltimes, and they are providing for a future parking ramp if it becomes necessary. Planner John Uban suggested that the school might consider bussing to tennis courts, etc. rather than on-campus facilities. He also commented on the fact that all the parking aisles dead end and recommended that some pass throughs be provided. Mayor Eggert then moved, seconded by Councilmember Ciernia, that the conditional use request be granted with the folloving conditions: (1) sufficient parking be maintained on site, (2) current copy of student rules and regulations to be kept on file with City, (3) management person to be designated cosmmity relations person, and (4) recreational programs will be provided by the school if it becomes a burden as the co®unity. Motion carried unanimously. Mayor Eggert suggested that Council discuss with the Fiscal Consultant the possibility of including Bradford Schools project in a tax increment district. The natter will be discussed at the December 12th meeting. Mayor Eggert coved, seconded by Councilmember Baldwin, that Ordinance No. 210 be adopted. Motion carried unanimously. ORDIh.ANC£ N0. 210 AMENDING ORDINANCE 38 REGARDING Iff1SBERSHIP OF TIfE FALCON HEIGHTS VOLUNTEER FIRE DEPARTMENT Clerk Adninfstrator Barnes informed Council that the office staff has obtained information on Physican's Health Plan and is requesting that Council consider changing from the present plan to PHP. Also presented were costs for a dental plan. Following a short discussion, Hayor Eggert roved, seconded by Councilmenber aaldvin, that if the PHP atiatter cannot be delayed until the next meeting, cad all eaployees agree Lj~-. U OF MN RETIREES coast . ) BRADFORD SC800LS CONDITIONAL USE APPROVED ORDINANCE N0. 210 CHA'~GE IN E*~LOTEE H~.F,LTH PLAN DISCUSSED Jack Y1epp, the Developer, stated that the Falcon Heights Fire Chief and Fire Marshal and Ramsey County Engineer have reviewed the plans. The University of Minnesota will soon be considering approval of the conceptplans. ATTACHMENT C-3 MINUTES SPECIAL CITY COUNCIL FETING ~ i.1 OCTOBER 25, 1984 A special meeting of the Falcon Heights City Council vas called at 7:30 P.tl. by Mayor Eggert. ..Lo order Alayor Eggert, Councilmembere Baldwin HardClerkAdministratorBarnes, Attorney~yan de portChhes~odyi~• Also resentP were PRESENT Councilmember Ciernia. gineer Schunicht. Gertrude Esteros, President of the University of Minnesota ReitreeCorporationpresentedbackgroundinformationonther e HousingminiumandintroducedDavidThorpandMiloTh p oposed retirReitow, Inc. ompson, (moo ement condo-and Attorney Jack Klepp. rP, Thompson and omPeon reviewed the preliminaplantopositionthebuildin ~' site plan and esplained that theythe ®uth and take advantage of itheuopen way to buffer the neighborhood tosite. The plan provides for 100 space surrounding the buildingwillbeundergroundunits, I5O pargarages) and extensive laads~ sPeces (part of whichtaping. ABSENT U OF IrA1 RETIREES HOUSING CORP. REFERRED TO PLANNING COI~4IISSION r 8cre .~_ ~ ~ a ;~! Per ~ , ~, (2~ ~ ~ _~:. ~'easing v. i3) ~eQjtce ~.de ~ 16 ~~r .thaa~2 vain ..YeZ~~set bask ~_ .~0 Following a discussion, Mayor E ~~- y Councilmember Hard, that the matter be referred to therPlanning Comaission fo5, 1984 meeting. Motion carried unanimously. r their November Mayor Eggert moved, seconded bAgendabeapproved. Y Councilmember Chestovich, that the ConsentMotioncarriedunanimously. 1• Falcon Heights Ambulance Report #2-075842• General Disbursements 10/11/84 - 10 25 84 $78,777.88SinkingFund / / 3• Liquor Disbursements 10/9/84 - 10 22 $11,862.884• General Payroll 10/1/64 - 10/15/84 /~ $ 149.505. Liquor Payroll 10/1/84 - 10/15/84 $ 6,742.056• Human Rights tlinutes of September 20, 1984 $ 4,700.237• Redevelopment Committee Minutes of October 16, 1984 ,8• Statement of Legal Services through September 30, 19849• Statement of Legal Services throu hwithBullseyeGolfProject g September 21, 1984 in Connection10. Prosecutor's Statement for September, 198411. Planner's Statement for September, 198412. Statement from Stoplestad, Brown 6inConnectionwithCommunityBuilding Problemsgh September 25, 198413. Building Inspector's Report for July, August, and September 1 14. Licenses: 984 General Contractors Asphalt Specialties Co. #12531900QuantAvenueS. Lakeland, ?~ 55403 Tree Triarain /Removal CONSENT AGENDA APPROVED Kraus Anderson Construction Co. #'1254525SouthEighthSt. inneapolis, I•Lti 55404 Btennes Shade Tree, 2nc. ~I255462OldBfShyavE NUTES ATTACHMENT C-4 At.ANlJ'DdG COI~~`iI SSION/PUBLI C HEkRI11G NOYAMHER 5, 1981 PANE 5 Member Mead saovsd delay in action oa the rezoning of the Crott property andnon'r-iiwation of the hearing until a suitable egreameat is reached. MeaaberIiilaenaecoadsdthemotion. lta:aber Slack offered an amendment to the motion that the City Couaei3.appoint a co:mnittee representing the interests of the people in the areasadtheLido, that a charter be ettggested and a tiwe lfmit vithia ~~to xork. Member iJallin seconded the lotion. IIpoa a vote being takenthefollowingvotedinfavorthereof: arittaer, 8ilaen, Stetaasoa,Wallin, Mead, Hlack and Trent•Sullivaa sad the tolltsrir~g ~tsd againstthesame: Chenoweth. Motion carried on 'the amenda-eat to the lain motion. A vote was then taken on the main motion and the tolla~it~g voted ~Savor thereof s Chenoweth, arittner, Pilsen, 3tetansoa, idallin, ?lead,Black and Trent-Sullivan. Notion carried nnaaimonsly. Bobbie Thomas asked that when a committee is _to~ed to !yu-ther diacnastheiaauexillthePlanningCca~niasion again consider the issue beforemak3.ng final approval. Comicilmember Cheatovich reviewed the pnblie hearingprocess. Chairman Stefansoa closed the public hearing at 9:55 P.?S. Gertrude Esteros, Director of the Board of Retirees Housing Corporation, ~.iloThor.:pson and Dav-~d Thorpe the •rchitects, and J2cv Elepp and Fran}; gubitschecktheLeveloperswerepresenttorequestvariancesat1b66Cotfm3n. Theyrevie~;ed the site plan shoxing the location of the structus-e, the open spaceandexplainedwfi~y the variances were needed, gll the Dniversity GroveresidentshavebeensurveyedandtheGrove ~-ssociation has been kept informedofdevelopnent6aswellastheUnivers_ty of I+iinnesota Planning Office.Bey reviewed: (1) placement of the retention pond, (2) Sire lanes have beenprov-~ded as requested b9 the Sire chief, (3) discreet lighting will be providedonthesite, (!~) there :ill be one outlet onto Larpeateur, Mich has beenapprovedbyBamseyCountywiththesecondaryaccessprovidedooCoftaan, (5)screening xill be provided along Larpenteur, t6) 6nsat parking will beprovided, (7) underground pas3dng vill be located mdsr the east sad vestvit~gs as xell as additional undeigrouad parldt~ tinder the gain structure,8) the reitrement age- built for people 55 or older carrently eaploged or .retired from the Dniversity oS ?Sianesotz, sad (9) it is gra3ected that 150peoplerillbelivingin100traits. Jack Klepp advised the Planning Co:~ission that the third variance previouslyrequestedonaideyardsetbackhadbeenxithdrawn. after a twrther discussioncoacer~.ng the height of the building it vas determined that another variancexouldbeneededtoaccaammodatethepitchoftheroot. r dohn Itbaa tat~d.~'.. r 'ado _,ot ~ " _ de =~~ $ ou3hd ,~ - bt8ia _ i :. ~ atero driae3~at verity. ~he~i'~y~~ tflt~stion on anaila or-+~rin~#,a,r3r s pert--is ie eve--_ -- fie ethrued li~inta'd. his,` th~he end _ eer' e3~tain i~TION ZU Tp.IJ1Y ACTT ~ ON 8E- ZONING 1Cy~IiT ZD 8STA3LI S~ CITIZEN' C~QiITTEE DTE ON NATION TO IELLAY PU3LIC HSARiNG BaBBIE TAOPIAS H£~.RI1;G CI„?SJ L ~TP~ .~_SI T:' kET1r.F.c,S O~SII~v eo~o:~Tlo oar^; u~~; ATTACHMENT C-5 IINUTES PI.AHI+TING CCt9~'SSSION/'PUS'-,IC SEARING IiDF~iHEk 5, 1981,a P4aE 6 L!'ter further discussion, Member Wallin mov .~eooaded„~r ~snbsr .~hano+rsth 9~RIANCES Z ~ f ~o~irva-.be ,~Ppr~ s . ~ , , ..: _ ~~-1PPROPFD tR~~t 2) denerity e flan l2 d~ellit~g tnaite per acre 6 ~e7ling taus per acre, sari (3) beight variance trap 30 feet to include a l~J12 pitched root. Motion approved naaaimously. . Me~aoraadum trap John Uhan dated October 2lt, 19811 regarding w®aary JbHN UBAN recamnendationa from the Daantoim Bsdevelo~pgnent tours trill be discnaesd SOAAND'Jt at the aaxt Planning Comaissioa meeting.3I9CUSSED 1T ~JCT Member i~lallin moved, seconded by Keaaber Nilsen, to ad~onra tie meeting MNETING at 11:00 P.H. Notion carried unanimously. DJOURNP',Et• J rry allin, Secretary v l~ ATTACHMENT D -1 NR~itB.AR CITZ COWiCIL !~E"1THC3 itC.i 27, 1983 Pam 3 s r V'' Council sevieMSd the quotation tros- TomnQr+a Firehouse issociatioa for purchase sad ioatallatioa of a Brea at a oust of =8,792.00. Couacil- sember Larson encpreaaed ooacern that the drsa iiould also include as automatic writch sel.~y that could bs activated is tae event of a disaster and did not rant the dren lSmited to bav3ag.it activated by the City. Ltter a thorough disausdoa, Coutrcilaambar Larson coved,seoaoded by Couacilaember Cheatovioh, that =9,292.po be mended to p~ntbhase sad install a dreg iocludit~ ao addit'Lona1 rel~pr. Notion oarrisd unaainoua~y. Mgor iias~ceatf an reviewed the Daly 21, 1983 lettear troa 9naaa phipps- Zooaa, Daivsrdty Grave Hcmeawaera lseociat3oa Pa=idgg Camenittee,l~eigardi~ •thair rsnusat to chaaae the two boar flarldffi a3Qna to ~,A dour parkin oa the nar~~tdel]. _eeat ttbm ~~Ho9t sad authorise the City staff to issue peamite to :. fitter a discuaeica ragardiag abainietrat3oa, gyps of stfctera (datedJoolor ended), tees mad Esther or mt 48 boar mtiae is mesded. Coaacil- aee~ber G~~eraia coved, seconded by Coancilmamber 7,araoei, to authorise the Clerk ldoli.aistrator to proceed yith tae ragneet for parkiijg changesafterconsultationtrS.th the City Staff sad Bamaey Comaty Sheriff+a Departa,eat regarding admi.ni.stration. Motion carried uaartimously. Couacilsnenber Larson moved, seconded by Mayor i~arkeatien, that the Clerk ~aistrator be authorized to purchase a Secretary+s Desk troy gehoe Office ~raiahiags at a cost of $1,095.00. Mot,+ion carried t~9nimpu8ly. Couacilm®ber Caress moved, seconded by Mayor Park®tien, that the Clerk administrator be authorized to purchase 54 folding chairs troan Hartrnan Office Equipment at a cost of $9.50 each. Motion carried unaaimousay. Council discussed the poaaibility of aoving the pou~g place for Precincts 2 and ~ to tae City A:ll due to the fact that Precinct t is in need of sore space sad parld,r~ and the preaec~t facility for Precinct 2 requires passage dawn a !light od stairs. fitter a discussion, it ws decided not to change Precinct 2 at this time. li~yor ~larkentiam saved, seconded by Covncilmamber Chsstovich,that 8eeolut3oa 8326 be adopted. Motion oarried naaaimoualy. 1. tiL8NI~3 SIRE1 0 ffi Pt~CHA38D F~ CI1T OfRYBE~SITY QROYB BHQIIESZ FQQ *1 HR++ P~INf3 & Pik P~IITS PPROYBD SBCRE'TARY + S DESK TO B,B PikiCBASFD FOF CITY OFFICE FOLDING CHAIF TO BE ORTI~RFT SCOSSION - PO~.LINI PLACF PRECINCT: a~ 2 HS.SOLDTIOH 836 R89QLDTION CHANC3I)U '~ PRECIICT POI.I.D~ PLLCS FOR PRBCIt~;T 1a OF T~ CITY tff' F,IGON HEIGHTS 1• tESOLUTION 83-26 Clerk ldtniaiatrator Barnes aaplainsd a proposed ot~dinance relating to PROPOSED refuse container enclosures. ~e tenants of the Hermes Shoppir~ REP'QSB CONT- Ceater are eacouatariag problems xith trash being takau out of the LII~ ENCLOS- du~aters and tb:txrn around. Councilmer~ber Cieraia questioned e}iether ~ ORDINAI~F a conditional use vou].d be required for such eocloaures. lttoraey DISCIISSID Yon de North advised that if the a~xiating ordinance is very atrict7,y enforced, it may deal rritb some of the problems. titer Earths: discussion,Council agra~ed oa more agressive enforcement of the eodatiag ordinance. ATTACHMENT D-2 iiitiTar.~ Ul.~tl ~i111 GJUI~?L 1~1"IIY~ 1fwY 25, ~9P3 P1~G~. 2 6f Councilmembers Larscn and Ciernia both indicated they had met ttith the CITIZiC15CitizettsDevelopmentCommitteeonDSay21, 1983. The Committee is interested COI~TTEEtineachCouncilmember ~ s personal reactions to the l.arpenteur/SnellinCdevelopmentrandeachCouncilmemberkillbeindividuallycontacted.. 2~layor Warkentien moved, seconded by Councilmer~ber Chestovich, that Close HIRIAIG OFandAssociatesbehiredasthePlannerfortheLaipenteur/Saeliing area. PLA'~r FGr.Councilraember Ches~gvich asked if menbers of the Citizen's Car~ittee were LAFcPENTEt1R/present durirl€ the interviewing of planners and xas advised that some. SNB.I.ID~ members xere in attendance. Councilmember Ciernia felt that since the IREA City does not own an.}* of the property other than the liquor stare, that DISCUSSED the City should aim the development to assure it is consistent ~~tt: the Co:aprehensive Plan, which, in his opinion, requires a different type of firer, that the Close Firm, xhich is directed more toxards architecture. die felt, from that respect, the Dahlgrea Firm had more eaperieace and more expertise in the area that is applicable to the City~s seeds. Council-member Trggert agreed that both presentations trere good bnt that the Dahlgren Firm, probably, does more of the kind of work that the City wouldbeexpectir~ -more plaanir~ sad to a lesser extent architecture. Kayor1~'arkentien also agreed that the Dahlgren firm is reliable but felt that theCloseFinwoul.c be more a.~:enable to accepting and implement_r~ s~gestions ~fror; the Citizen's Co.*!r-.ittee. Dina Stem~:edel, states her husband attea3ed the ::nte:•r3.eti: r~,eetings and felt the Da_~-ilgren firr~ t.•as more open r.::nded any' illir~ +„o accept s~gestiens because the Close Fib is rore s:critectuxa'_ly~/ // ~i^.de~. Cci-~ciir:e-~ber Chsstc Bch :elt bl.t?~ pl~~-~ers xoul:; ti:er:::~ k +,.~.e __~r j~rCo-•r:ittee. Gourc_1,•~e--:ber Larson co;*~ented that the firbs approac':e3 tx;e ~ttly proble.L drifi e: e:^13-, t.~:e Close Firs: addressin€ the entire area, net 3ust ~// 7)'the nc: tti} East c,4~d_ an ~. Lfipon a vote bei*i.€ tz_{ea, the fo'_? oz:_nE : otsc in favor thereo_: i:aycr kar::eatiea and Cou.^c~^~e:-ber iarson, ar.~ `.~:e fcilo~Zr~~~. f/~votes n€a,ns;. the sa'e: Councilsr.e:nbers Cierria 2na E,gge: ;,. Cc•~ci?r,e:_ber ~ Ghestovich abstained due to the fact that she xes not in attenca^.ce at t~~:e intervyews. N~^tion defesteC. n, Qyas iq 83 xC~,l~ ~;:-~- Couacilme•nber Tggert moved, seconded by Councilmember Ciernia, that G&1+1 & l~SSCr'.. Naward Dahlgren and associates be hired as the Planner for the Larpenteur/ ~-cID Ta idG:,; Snelling area. IIpon a vote being taken, the follmring voted in favor ON LARF~Y'T~iirthereof: I+~yor L'arkentiea, Councilme~ebers Vert, Larson sad Ciernia, sad S:~.LING the lo1loF:it~ voted against .the same: None. Councilmember Chestovich DE4EiCPi.:~'.'- abstained. 13otion carried. parcel Eicbter, 2132 Folwell, reported on the University Grove parking Cd'sOFE Plu::I::; situation and aoggested solutions. Councilirenber Larson reviewed the DISvuSS:.J St. Aathor~ Park parking pe_~:*,its,. however, l+•r. Ric + * i ~~~+~.; +ke sident do not grant dearly aa_~TtE perl^3ts. lifter adiscuss-yon, the Clerk Aa~nistrator xas directed to meet ~•itt: a representative of tt;e University Grove Parid.ng Cor~~ttee and Captain Spencer of the Sher~f~s Depart.:,eat to work out an ar.:cable solution. N.a}ror karke-:tien referred to a letter dated April 22, 1943 fro:; Carl ~~::;IirS Dale, P1a:.~~inE Coass:tas:t, regari~ri€ the zoning c_° the remainder of ZG..'II3C the iizk;fins %state. Council•n~ber Cie:~i:a reported that t1:e Plar*iint, DISCJSSr:D Ca~.~ss:cn `'e'_t t_~:at a prudent ~e^~r,~ for ate fire acres xoti:c be 3-I zorir~, ~,: ~ t,.':e prcvisicns o~ Sect:o^. 1r .; ^= t.~:e cLrren: zo^r t,ordira.:.ce aprlr ri< be+.t, Gcun_:~~e Hers C_e ~, a a.:a LarsoT fe'_t the Pla_ti ; r{; Ce.-: =ss on' E de=iE_on s~ioa:C be suppo:•tei rS Coe:acil. T'^+~- -y..~ V ~ilr 4~-v~r. ~y CVTN•.v P.~1 11, 1983 PdGE 5 J S.iTI:JG ATTACHMENT D-3 5'7 inpu! frnm s professional planner to assist in completion o!' the re- pLt,~,~y~ritin~~ e° the Zoning Ordinance and specifically requested Carl Dale (cont.)se be is familiar with. the Ordinance has korked xith the Piaani~Commission previously and is best suited to recognize the needs of theCity. Harold Nilsen, Plannit~ Comcaiaeion ::e:..`.+Er, advised that lcr. Latecouldgo, through the proposed zonit~ ordinance and xeed out the ua- aecessary port' ons. Couacil.~,et~ber Ciernia Roved, seconded b; Co~nci7-'member Larson, that the Clem gdininistrator be authorized to negotiateanagrea:.ent with Carl Dale, tdhich should be presented to the Councilforrevioti: at a later date. Motion carr=ed unani~aously. Jir: l~.aemer, represeatiz~ the Cha.^les Hankins bst~ate iafo~aed that the JAtf~.SaccountantfortheEstateisoftheopinionthatttiesubdivisionfeeisaMdF.t~'iiliability, xhich must be shos.-n on the final accounting to the Pro'~ate Countand, therEforE, they need the dollar amount established. It is his opinionandtheopinionoftheCondemrntionCou.^t that the S-ZG land is econ~..i-cally valueless and the a-2 and x-1 are econo:•3cally obsolesent. He re-quested alist of appraisers frown the City to establish a value for thelead. Mayor karksntien asked if the severeace damages awarded by theCourtxouldhaveappliedtothelandifithadbeenzonedallisone zonit~ area tc ~,~ich Ns. ~:aenner replied that M~~ reason damages xereati:ardEd t:~s bECS•,:so t.hs lb-'_~ lot k~° L' ~ti`•; 3i :~ '_e. Cc~...nc'3rse~ber r~ertea~ressec ccncerr. that tt:E Git~ not be 'tou:.d at a 7..ate: date b; t*;e figureies ___ s!:ec at this ti_*- ''- ''--~-~ :t_tec t~tat t~:e va_L;. tr_ }j e i jr»--'; d c ~.ti:E i':...::6 C~ t~":E ~~^.. fit ;t.}.c ±,~,., ..C~:'~CTI Il^t _~ tti'~t'-.E cr s~iE cr do-v eiop-:Ea;. C: t~:e lsxc. gttc:•oe~- Y~,u de I~or~': st~;~esteitf, ~. ~ ty.:' r C .~. On; r. }` C C.i ° _ ;'_ ^ _ y .7 `. +` ^ ~,. d et „C. ~ ~E~ ~ E 5 =`~'.' ActiCT2 Of 4c~ ue 1 g :..o~E . cr :~:.r':e::.; e:.. efe:: s:. t^ a lette^ o_° 1`- 2 R~ ~- • TYcn~ - ~ ~ '~-~ ~ 19. ~ fro-: Sus=n P.-=pps- J2.TT:~...IT1'1 [Q~ •~l_^-CE_^. :., ~i~"io~~'!Jer SQ:i Ci j~i° ~J :'_Z'8:"r1t~ G~OVe p~='_!?:,ti„ uC.i.3~ - ~L~'~~ Pc..L~:i-tt~~.re:,~sestir~; c'~a-des is the par'sn~ .iEns in t?-te Grove-mod iss~:.nce I2;1 ~'Tr, ;or p=r:.-n6 pe:r..~ is t^ residents. T::e r.~.tter k~s deferred until a reore- D~'F.c,:.%~,se::tat:ve of t~:e G_ cti~E Pte! rti, io:~-'t:,EC co;:'__ LE ir. at~.Eaao21CE :._ d~ sctissalternativess~sch as the pa.rk+ng system used in St. /lnthoz~ P:~'r. 1 request fsbr.~ Bamsey County that ~'No Paring" signs be placed on bo Mh FAIFtYIE'i~:sides of Faiz~ie~: orenue vas discussed. Co•,u~c:3m~ber Larson r~uested "~10 P!-FwI::G'that the Clerk /ldainistrator aotif~ the Fairvies avenue residents to REQUESTputinxx-itin€ their fee's as to viether or not they- wish t~:e park- AEF'~.~3itsban. The r.~tte~ will be discussed at the n~ Council fleeting andallinterestedpan=es till be imrited to attend, includit~ BamseyCounty. Mayor Warkent;en corr~eated on the erents rega.^dinE Councilr~ber 3~,tertts ?l~.YQR~Sallegationsre~ardn6 the hiring of a Cit<, P],anner. He stzj.,ed thst the C0:•L~.%;;T:. C:;Clerk 6d~~ni st.^ator, as requested, h~.d contacted Car? Ja? a fo: as-es or Bi~;~i T~planners qu~fied to ~-c:-y on the deveiop~-gent of t2:e La.^peateur,~5ne_lir~ 03T~,I:; i:~'.•~:: area. Mr. D~ a vas reluctant to give napes of his cor1pet;ta: s a.;.d, OF PL~.~irF.:.:.ins'„ead, c'~ose hi^.se'_f to attend the reet'_~. ATTACHMENT D-4 MINUTES 6 L REGULAR IL KEETINC MAY 26,19 PAGE 2 Ba i i drnesnqure as to whether Ordinance 69 could be amended and PARK DEDICATION Attorney Swanson advised that it could but he feels that a new continued)ordinance should be written as it would be a better way to accomplish the beat results. The Planning Commission is in the process of rewriting the soning ordinances. Councilseaber Eggert feels that a special ordinance should be adopted as expeditiously as possible. Attorney 5~,ianson vas asked to prepare a draft ordinance, which will be discussed at the next Council seeting. Mayor Warkentien coved, seconded by Councilaesber Chestrn-ich, that RESOLUTION Resolution 82-19 be adopted as presented. Motion carried 92-19 unanimously. RESOLUTION 82-19 A RESOLUTION ON THE DEATH OF ROSEVILLE POLICE OFFICER BRUCE RUSSELL the Clerk Administrator was asked to send a espy of this Resolution to the warden of the prison in Leavenworth, Kansas. Councilmember Larson wanted to know why the flag was not flown at half mast in honor of police officer, Bruce Russell. Councilsember Ciernia felt that we should check what the other cities are doing and follow the same rules. Councilmember Larson pointed out that a flag can be flown 24 hours a day. Councilmember Ciernia requested that the Fire Departsent of Falcon FIRE DEPARTMENT Heights receive a commendation since they donated their time when COMMENDATION they provided emergency medical assistance and assistance during the search. Councilmember Ciernia lade a motion, seconded by Council- member Larson, that we recognize and appreciate the service that our Fire Department provided on that date and this was service above and beyond the call of duty in a difficult situation-this service beingdor-ated by the Fire Department. Motion. carried ~animously. Clerk Administrator Barnes inforaed the Council that belss received a PARKING FERMI number of requests for special parking permits. Councilaember UNIVERSITY GROVE Chestovich pointed out that Lbe University Grove Association initiate the. two hour , therefore, it should be referred to t em or a proposal to change the parking. Councilmember Eggert stated that he felt no special permits should be issaed in the mean- time. Clerk Administrator Barnes requested authorization for payment of PAYMEKf AUTHOR- police and fire payroll from the general fund due to the fact that RATION FOR the .liquor sales have dropped. This is a tesiporary aeasure. Council- POLICE AND FIRE ember Larson moved, seconded by Mayor Warkentien, that the Clerk FROM GENERAL Administrator be authorized to make these payments from the general FOND fund. Motion carried unanimously. K.eith Hofeld, K b K Hardware submitted a letter dated Ma KEITH Fy20, 1982, 80 ELD K b K HARDii~R E ATTACHMENT D-5 MINUTES r REGULAR CITY COUNCIL MEETING JANUARY 23, 1980 A regular meeting of the Falcon Heights City Council vas called to order by Mayor Warken[ien at 7:30 p.m. Mayor {Jarkentien, Councilmembers Steele, Brova, Eggezt sad Larson. Also present vas Clerk Administrator Barnes. . None. Councilmembez Brava coved, seconded by Council ember Bggert that the Consent Agenda be approved as presented. Motion carried unani- mously. 1. Fire a Rescue Reports X00180 - X00280 2. General Payroll 1/1/80 - 1/15/80 $ 3,$95.25 3. Liquor Payroll 1/1/80 - 1/15/80 ~ $ 2,326.91 4.' General Disbursements 1/1/80 - 1/23/80 $28,429.27 Sinking Fund - $ 7.841.50 5. Liquor Disbursements 1/4/80 - 1/21/80 $28,692.99 Sinking Fund $ 2,263.75 6. Building Inspector's Report, December, 1979 7. Ramsey County Sheriff's Department Report, December, 1979 Councilmember Steele moved, seconded by Councilmember Brown that the Minutes of January 8, 1980 be approved as written. Motion carried unanimously. 7 y ABSENT tANSENT . AGFJIDA APPROVED MINUTES OF JAN. 8, 1980 APPROVED Councilmember Brown moved, seconded by Councilmember Larson that the MINUTES OF JAN. Minutes of the Special Council-Planning Casmissioa Meeting of January 14, 1980 APPROVED 14, 1980 be approved as presented. Motion carried nnaaiaously. Frank Paskevitz, 2120 W. Hoyt, representing residents in that area, KO PARKIDIG ON rese ouncil a petition for "No Parking8 a.~. Lo 4 ~.m., N_ ORTH SIDE OF weekdays" oa the north side o Hoyt from Folvell to Coffaaa. Mr. FROM FOLWELL Paskewitz stated that due to cars parked on the street, the snow TO COFFMAN (8 A?i ploy cannot completely clean the street, thus narrowing the driving TO 4P!! YEEtmAYS) area of the street to one lane, caking it difficult for buses and emergency vehicles to drive Lhrough. After some discussion Council- member Steele moved, seconded by Councilmember Bzown that the request be granted and that the Clerk Administrator be authorized to place No Parking 8 a.m. to 4 p.m. Weekdays" on the north side of Hoyt • from Folvell to Coffman. Motion carried unanimously. Dirs. Kurt Bjorklund, 1511 W. Larpenteur, addressed Council re- NO TRUCK PARKING questing that the "No Tzuck Parking" signs on. the east side of Axona ON AROMA DIS- from Larpenteuz to Czavfozd stipulate weight limits in order to re- CUSSIOh strict large comaercial trucks and allow parking of pickups awned by zesidents. Councilmember Steele informed Mrs.,Bjorklund that~he felt weight limits would Daily lead to confusion cad since the original intent ATTACHMENT D-6 8 8 It xae Canncil concenaue that the Mrs Deparb~snt xae called FZBE anaeceaaarily to the Btnbera Restaurant parking lot recently, REApHTS therefore, the tolloxing motion xae a~ades Moved blr Mep-or Warkent3en, seconded b7 CounciLan Steele to bill the ~1~9.00 eocpenae involrsd in ansf+er3a~ Fire Report lio. 2 1976 o the Ra:~aey Counter ~eritP ~ e Deparaent. Dpon a tote being taken, .the tolloxin~g toted "aye^: Mayor kTarksntien, Councilsen Hlaclc, Steele,and Labaleatra, and the tollo~ring toted •nay"s Hone. Motion carried. Fire reports 106. 85, 86 (1975), and Toe. 1, 3s ~+s 5 0976) xsre noted. Moved by Mayor Warkentisn, seconded by Goancilsian Slack to approve GIaI~TTE the Cigarette Lioaaae, To. 1~3q, for 8orbert Lucas, Haaline Foods, ISCBbiSE ~1i3915?9 Borth Hemline lvenue. Upon a rote being taken, the following voted "aye" s Mayor i~Tarkentien, Counc3lsien Black, Steele, and Laba- leatra, and the tolloxing toted "nay"s Tone. Motion carried. Moved b9 Councilman Black, seconded by Coaacilaaa I.abaleatra to >~-7>FI+pgC~AT- apprcve License 1133 for Ton-Into~d.cating Malt Liquor salsa I~ MILT issued to Norbert Lucas, Bemliae Foods, 1578 lforfib Hamline lvenne. LIQDDH LICENSE Upon a vote being taken, the followiing voted "aye": Mayor Warken- #133 tien, Councilmen Black, Steele, sad I.abaleBtra, and the following voted 'nay": None. Motion carried. Councilman Labalestra introduced the following Be solution and RESOLUTION moved its adoption: N0. 76-b: POSTING ~~NO RESOLUTION N0. 76-6 PAFiBING" SIG;: S 0 02t OLk'E~,LQARESDLUTI02iAUTHQrZIZINGTHEPOSTINGOF „NO PARSING" AYE6-DL_ SIGNS ON THE EAST SII~ OF F'QIi~IS AVENUE STAxTIldG AT INTgiSSCTION WITH HOYT 1Yffi~i]E 1ND PBOC : ING NORTH 300 FAT Councilman Steele seconded tt~e toragoing Resolution, sad upon a vote being taken thereon, the tolloWing toted in favor thereof: Mayor i~larkeatien, Councilmen Black, Steals, and I.abalestra, and the tollo~wiag toted against the acme: Tone. Motion carried. e need for these signs xas determined men it xas noticed that the width o! the etree t and because oS snow banks sad cars pa oa both Bides, access for asergency vehicles or buses trould be difficult. Moved by Councilman Slack, aecoaded b7 Councilman Labalestra to GBNE~.. approve the General Dieburaeneuts in the anonnt of X5,579.60. ~SBTki~NTS Upon a vote bai~gg taken, the following toted •aye": Iiayor i~Tarkentien, Councilmenl Blsck, Steele, and Iabalestra, and the fOlloxing 10~ed "nab' : One. 1rlotiOA carried. ATTACHMENT D-7 ---- CITT OF FALCON HBI~HTS Pursuant to dae call and notSce thereof, a regular aestigg of the City Council of the City of Falcon Heights, Minoeeota, xas bald oa the 6th da, of Januar~r, 1976. The follariag aeAbera were present: Myor Narksatien, Conncilsen Black, Stsele, and Labaleatra, and the folloi+ing wre absent: Conacilaan scklnnd. Counciluan I.abaleatra introduced the folloxigg ~erolntion sadsowedateadoption: RESOZOTION 110. 76-6 BESQLUTION ADTHOBIZ,IIiG ~ PO~IHG ~' "IiQ PABSIIG" 3I(11S ON THS BLS7 SIB OF FOI~is AVID il~.dS, a discussion vsa bald b7 the Falcon Heights Cif Council in regard to ooeplainta reeeixed by the City of tba parking problaaa on Folxell tvenne starting at the intersection with Hoyt A~enne and proceeding north 300 feet, and EEAS, it xas noted that the xidth of the street xas only 30 feet, and WH~.z'~S, snox banks and cars parked on both sides of the street licit the accessibility of emergency vehicles and buses, TI~.r'~'OR£, HE IT HE~~EBY RESbLVED, that the City Council of the City of Falcon Heights does hereby authorise the installation of "I~o Parking" signs on the east side of Folxell Avenue starting at the inter- section xith Hoyt Avenue and processing north for 300 feet to allaviate the traffic situation. i~REtJPON, the Seaolution xas declared dull passed and adopted. Passed by the City Council tbia $th dagr of Jannar~r, 7,76 AT~ST: erraa S. Barnes, Clerk Ad:siaiatrator The notion .for the adoption of the farggoigg Bssolntion x+as du7,ysecondedbyCouncilAanSteele, and epon • •ote bei~ taken thereon, the tollcaring Toted in favor thereof; Mayor Nark®tien, Conncilsen ffiack,Steele, and Labaleatra, and the follcarl.ng Toted against the sane: lions. N,II~IS C. A. ~itAE~i, Mayor 1 ., C ATT D-8 UNIVERSITY OF MINNESOTA TWIN CITIES January 8,.1976 Physical Planning 503 Morrill Hall Minneapolis, Minnesota 55455 612) 373-5765 Mr. Dewan B. Barnes Clerk-Administrator 1644 West Larpenteur Avenue, Falcon Heights, MN 55113 Dear Mr. Barnes: 7 ~/~ ago yak a ~~s r t It appears that the parking restriction signs on both sides of-the street along Folrrell Avenue Rave been removed. It has been observed that autos parked on the street, especially along the curve, mayimpedeemergencyandmaintenancevehiclesaswellasbuses. Therefore, we request that the parking restriction signs be replaced on both sides of the street as had been the case prior to their removal. Please contact me if you have any questions regarding this matter. Thank you for your cooperation. - Sincerely, s,~,, ~. Stephen R. Markowitz Coordinating Planner SRM:rr cc: Captain James McDonough University of Minnesota Police Department ATTACHMENT D-9 r J ' , ~ 96 Vincent Street St. Paul, ZQI SS108 ~ ~ n ~. »). y 2 , 1983 r. Dewan Barnes 2077 ji. Larpeateur Avenue Falcon fieiahts, MN 55113 Dear Mr. Barnes: i,I` ~I~IAY 3.~rt' .. Because of concerns 'that nanny of the IIniveraity Grove residents expressed, Frank8usta, President of ythe IIaivarsity Grove Hose Owners Association, appointed aparkingcommitteetoexasiaetheparkingsituationistheGrove. This ca®ittee,hich was chaired by Susan Phipps-Yvnas, Yice President of the Grove Hose OwnersAssociation, included •esbers from all parts of the Grove. fie set for the firsttimeonFebruary1,7, 1983 and decided that it sas necessary to conduct a surveyoftheGroveresidentsin=order to determai.ne the ezteat and nature of their park-ing cosplaiats. A survey eras sailed out to every residence in the Grove the fol-lowingweek. _ it was _ indicated that every household that Mshed to Gave a voiceia~the policy decisions would have to return its survey before April 1, 1983.On April 10, 1983, the cossittee ~t again to revien the results of the survey.Sizty five of the 103 surveys that bitd been sent out sere returned. On the basisoftheresponses, the parking committee Generated recommendations which aredescribedbelow. The residents at the west end of the Grove are satisfied basically with the twahourlimitduringweekdays. However, the consensus among the residents east ofCoffmanStreetisthatthetwohourlimitprovidestoomuchtimeforstudents,staff, and faculty to come and park their cars while attending a single classonthecampus. Their parking creates a number of problems which Grove residentswouldliketoseeeliminated. For this reason, we are requesting that you limitparkingeastofCoffmantoonehourbetween8:00 a.m. and 4:00 p.m. on HondaythroughPriday. Since there is no parking currently allowed on Hoyt Avenue, thisrestrictionwouldapplyonlytoPolwellAvenue. We are also requesting that thecurrentprohibitiononparkingonthesegmentofFolwellwherethestreetruns.forth and south be continued; trowever, we mould life to see .that this prohibitionstartat .the nest end of 2098 Folwell instead of farther nest as it now does. Many .residents throughout the Grove have coiplained about the difficulties ofhavingparkingonbothsidesofthestreetdurinGLhewintermonths. Therefore,we are requesting that parking be litited to the north side of Fo1weI1 and tothewestaidesofBurton, liorthrnp and Vincent for the period commencing November15endingApril1S. Having learned of the arraageseat for daily parking permits which is now allowedinSt. Anthony Park, a number of individuals suggested that we develop a similarsystesfortheGrove. A aa~ority of the Grvve residents voted favorably on thisoption. Therefore, we request your peraission to institute a daily permit systemthatwouldbeadsinisteredbyGroveresidents. Our plan is to issue an unlimitedmasherofpersits, for special events only, that would be rood for an entireday. ?hese would be purchased at a minimal cost to cover duplication expensesfrom ^embezs of the parking comaittee. Ye intend to include all of the information reviewed above in a newsletter that ATTACHMENT D-10 Page two May 2, 1983 sill be sent to all residents of the Grove; hoMever, ~e Mill aced to•taov priortoMritingsuchaletterthatour =ecoa~eadatioas are acceptable•to Zalconeights. Please let na knout Mhether or not you forsee any probleas in the chargesthatMearerequesting. I t~-ould be happy to talk Mith you if you have questionsthatIhavesotyetaddressed. Your titaely response and tooperation_Mill be ap-preciated. ' Sincerely, f , Susan Phipps-Yonas ~ ~ • Chairperson, University Grove Parking Committee SPY/nv ~ - ATTACHMENT D-11 rts. Janet wiessner J?'9~87Clerk) Administrator City of falcon ilright~ 2077 Larpenteur Ave. Falcon Heights, Mn. 5j 1 ~ J Dear Ms. Wiesner, Sue and I appreciated the opportunity to meet with you this pass Tuesday. . Our understanding of the issues we discussed is as follows: 1-Recycling. We shall contact Supercycle to explore the possibility of obtaining some recycling containers to be used fn the Grove on a trial basis. 2- Leaf pickup. It is aaparentiy unfeasible for the city to Initiate any leaf pickup program in the near future. Nevertheless, the City Council should be urged to continue their discussion of the matter. A letter to that effect has been sent to the City Council. _ 3- Parking permits. We discussed the possibility and the attendant problers involved in obtaining permanent resident parking permits for Grove re°idents. You agreed to tnvest~gate the matter further and that werrcuiddiscussthematteragaininamonthorso. Street lights. 'dre d~;,cuJJed both the replacement of eXistinq 1iGr~ts o~ Fol~~,~ell St., and the installation of lights on the north-south sire`:`l.~ vi Eurton, tJorthrup and Vincent. ',With regard tq the replacement o` t7e ~ol~~~ell 1ly^ +ts you pointed out that such replacement will involve some disruption of se~~ice, ar,d considerable disruption of streets and sidewalf;s. You suggested that the residents be apprised of this and be given the Choice of whether or not they wish the Change. ~vith regard to the installation of new lights, we agreed to activate our street lights committee and to contact Mr. Ron Vanelll (sp?) of NSP and arrange to gethisassessmentastonumberoflightsnecessary, placement, etc. Then, ai the appropriate time we shall present our findings and request to the CityCouncil. - I am enclosing a letter from a previous City Clerk to residents of the Grove, outlining some points of particular interest to the residents. If youthinkitisappropriateanduseful, please look it over, make any changes,corrections and additions and I will see that it Is sent out #o the Grave residents. Again, thank you for meeting with us, and I look torvvard to workingWithyoU. Yours sincerely, J~~_~~. Martin Dv~~erkin President, University Grove Association ATTACHMENT E-1 FALCON HEIGHTS 207 W. LARPENTEUR AVENUE FALCON HEIGHTS, MN 55113.5594 PHONE 612.644-5050 December 17, 1987 T0: Jan Wiessner Clerk Administrator FROM: Shirley Chenoweth RE: Permit Parking On this date I contacted Don Tuftey who was in charge of the St. Paul permittingsystematitsinception, and Carl Johnson, the present Director. St. Paul permits are-issued to residents only on an annual: basis for a $20 fee. (Septem'~2r)I asked if there could be a problem with discrimination and Don said they had re-searched the matter and were assured it was entirely prgper for governing bodiestousesuchapermitsysitem. He explained the concept originated in Washington,D.C. (Arlington County), in an area where commuters were parking on city streets.When the permitting system began, several commuting attorneys lost their on-street parking and took it to court. The matter was eventually taken to theSupremeCourtandthatbodyruledthat';$vvernng bodie da have the rightprov^idad they can show a beaef#t to th! c#tr.~s, i+e. ety, Quality ofZ~fe, trs#f#c rsductio~, pollutcur~-noise end sir, ete.'; St. Paul established an enabling ordinance, then designates neighborhoods byresolution. Carl said the program was in signs, administrati the red the first two years; due to purchase of ve costs, residence, however, he indica etc. They are now breaking even ted there a l at $10 per They have limited the nu~ber of permits re a ot of administra in some ea tive costs. i.e. black marketing permits,residents ar s at there purchasing permits and vas some abuse selling them to P a~~~I L S'`students for up to $150.00. Carl also stressed that we should be sure all residents understand the systemtheyquiteoftenthinktheschool/business creating the problem should pay thefee.) Some will object to paying to use their own street. St. Paul holdstwoorthreeinformationalmeetingstothoroughlyexplainthesystem. He also recommended appcinting one citizen to be involved in the decision 7 ~ ~'~"making (someone they can trust) as residents are sometimes suspicious ofgovernmentalunits. MOVIE OF THE MINNESOTA STAT£ FAIR AND THE U OF M INSTITUTE OF AGRICULTURE ATTACHMENT E-2 R 2- Carl is sending copies of .their enabling ordinance and any other documents he feels might be helpful. SC:kjz ATTACHMENT E-3 r~ a SAINT PAUL PUBLIC WORKS CITY OF SAINT PAUL DEPARTMENT OF PUBLIC WORKS TRAFFIC DIVISION 800 City Hall Annex, 25 West Fourth Street St. Paul. Minnesota 55102 612-298-4701 LETTER OF TRANSMITTAL T0: S 4~~t ~ . ,N~~ SS/~,~ DATE: ~~~ RE: ATTACHED UNDER SEPARATE COVER BY LETTER DRAWING PLANS Copies Description N 1Q.~ l ~ / G.. l t ~-sro •~i Note and Return Review and Comment Information As kequested For Signature REMARKS: r~~ cc From. ~ J g~ -C19/ ATTACHMENT E-4 4 Ili7.l~1 b) No plsttes or stirkrrs sh:+ll ix• i.xuc+t fur an\• vehicle unless .uch vlrhicle li-r which the permit is. requested i:: usl•d exclusi\•ely fur the pickup and delivery of merchandise and not as incidental to another or prin+ary uxc, Sec. IG7.ll.5. 1'I:ItI•.%~tirkl•r.. J lal 1)i./,u.al u/ plnlr:e ur sfirl.•r•rs. 11'hr~r+ :u-~• ~•e• hicle for ~rhi~h s}-ccial p:u•kin~; }x:rmit }-Ialcs ur• stickers h:,s been iseucd is disposed of by the business which made origin:-1 applir.-tiun for such permit, the plates or• stickers must be destroyed and removed so as to preclude the use of such vehicle and plates or stickers by any other per' son. The permittee shall also notify the license inspector that such permit is no longer valid. b) Replncentent vehicle pletes or sticktrs. New plates of stickers may be issued to the same busi- ness for a replacement vehicle under the original application upon payment of a ten dollar (510.00) fee. Chapter 168. Residential Permit Parking- Guidelines and Regulations' Sec. 168.01. Declpration o~ public policy and purpose. The council of the City of aint Paul finds. that there are residential areas wi in the City of Saint Paui which are adjacent to r very near intense nonresidential uses which do of provide adequate oft'-strett parking. 1'he counc I further finds that persons ttnployetl fiy or vain • tha+se nonrr,iden- tiaJ fsl<cilitirv fn.~ucntly par their vehicle+ on nearby rr~identisil sttrects. r ',fulling in si:riousresidentialproblems. This ps><r ing ordina~noe regu•tittil:~ig }mrkitnc itt designated easidential areas is hereby established in order protect, children and Mher Ixde4iriihns frnm ily injury and to pratcla :real and Ix•r;:tinal pro •rty Gom d:nnage tn• rethtl;nl; haxssrdvus traffi conditions r-•.ult• ink; fr•v,m the licsl\_\• ir:l~i.• ut'thc.• , rtsickntial,~•ot,. by ttt-ltrt~sd/:nts itr tran.ient ; ur protect thu,e rtsidental arl.•stes fron- Ix-ilist~~c1 fir. rsty:ci\~: noi:;l~, and ~•siah and tafusc causal h • tht• entry of ::uch' eltitlet; to prot»bte ef~icicncy n' the maintcnancc ditor's Hole-'t'his ehaplrr a J,•n~.vl (rnm l?rd Nu 17Q1'1, etloplcJ .\u~; 2. t98J. IYUt~ of lhorle rdre ,ts in a clrrrn -nd safe canditiun; to prtsrerve flee' rharpctcr of ths-st• dis;trictsc :r+ rcxi~ dcnlinl distr• !x; to prl-tt~t thc• nsticknt:z t-Ctlut.+c arc»s from it re:ts/-n:-E>It• brrrdrns in gaining nc• ccstc la their /•./lc~tcc~; :rrtd U-1-re.l~r\v tl-.~ gcn• ernl hcallli.. -fi•tt.,w•.•tlara• and intr•grit\• of tb,•r ros+idcnlx and rei/tcv-1 i:ll arc:-.. Sec. 168.0'1. Residential parkinb permit areas authorircd. The counci ,after follo+eitag the procedures in this chapter. a}•i~trestsrblish and des- ignate reside tial areas or parts thereat sts resi• . dential permi' parkittg'areas. On•strret parkinb may be limi or restricted to such areas to ccr• fain bcatiotus ht-acs. times s~ndl4ar• automobiles as may be r lam' i~r this c?rtapter. $uch designations 1 be for sash period as;the caun• cif ntay de ~ ~ •ne as being appropriate. Sec. 168.03. Fetition. a) The designation of a residential permit park' ing area shall ibe initiated by a petition-filed with the director of public \vorks staling th:-t a particL ular residential) area is cnel-untering serious r•es- idential probletits becatse of e~cessire parkin},' by~ nonresidents ~~•ho are associated with nearbe non' residential uses: A filing fee of tet- dollars f3iA.001 shall accompany every petition. b) The petition must specifically st,+te the se- rious problems bein}; causal h~• nonresidenti:+I parkin};, the spE•cific residential area to tx r~•stricted and the parking hrnn•. -rhich are to i-e mxtrictl•d. ~~` a ~a t k r ta,l• .l~r 8 blAcl:.done block t-ce is defined as one side of the ~~~ street for one block) or four thousand t-1.000- !in- d~~ eal feet block trontetk-e. A'o petition sh;+lt txr c~n- sidered if it faits to meet either of thc.~r• minimal requirentcnt,. 1~~~.~ucl~ISh1Ar•~icoCln•t•1a11'tspi+vl p„~p•aum+~`~'ti`'.~Lisd~r sire zinik*d ~fi •' U -~ n crs, tar purposes of this Rl~ction, shah me:u- fee ownership as rccurdrrl in the appropriate otTicc of recordation for R:unscy Cuunt~•. Une owner per residence' buitdirry~ or muttid-~•cltinl:; boil<liny; .hall ATTACHMENT E-5 rn be allowed to sign the petition. In the case of multiple o\\•n~~rship, only one owner may si{fn nn Ix~half of the ownership. No signature shall be considered where multiple ownert; of a alruMurc u•r nut :Il,lc to at,7-cc on whether or not the arch shc,ul(I ha\•.• rt•sidenlial lx~rmit parkin;. td- I•:arh .itmer shall thereon write his/lur name and address. r1n}• n:unc appearinb on the petition nut conforming to the residency requirement at the time of the petition shall be stricken and shall not be included. Any signer may withdraw his name. by filing a written request with the dir•eclor pr•iur• to the public hearing required here• in. if for an}• reason the number of signers falls below sixty (60) percent prior to the public hear- ing, the petition shaft be deemed defective and shall not be considered. e) Each separate page of the petition shall have ap)>ended thereto a certificate, verified by oath, that each signature was signed by the person purporting to have signed the petition. The peti- tion shall designate a resident who shall have the respunsibilit\• of verifying each separate pa6e of signatures, as \\•ell as having the responsibility of assistirtb the dir•ecior in the investigation oC the request to implement a residential permit park- in6 progt•am in the proposed area. Sec. 168.04. Initial investigation; appeal. When a petition is received by the director al- Ic•in{; that serious problems in the defined resi- drntial area :Ire c:tttstd b}+ exrnssi~•c parking; by nanr~~s~d••nr~ tiorn nearby nonr~irJential uaec, in- cl( dt ~{;, but not limited tot commercial, office or chcull uses. hnd after the ~eliticut hoc been v~l~- datt`(t: thtr dircrt.a• of public works shall make an Iflllla) tlt\'(•~(1:;:It1011 trl itti5l'Sti thl It:ItUl'l' :Ind l`X• tc•rt; „t' th~• t,rul,Icnr~, iC any, cau.ed by nunresi• r,tr:,l I,ark,at;. 11 the cGrcrctur runt•lucles that Llte I,rul,l,•r,r:.u lark thrn•,,1 +In n„t \\:rr•r:utt tht• cle:~ t.•n:,;,.•rt ,~t :, r,•.rrl,•nt i;,l pc~rntil f~:u•kin;; :u•ra. Iltr dtr,•rlur :1,x11 ~ulunit him cnnclu;imt \\•ith •ui3,m•l ink .:alen„•ntn In the council antl the si(;nc•r r,l• tlt,• r,•rttl"ic.rt,~ In such nn e\•cnt, the r„uncil tn:rv acl„f,l tl,c• r,•r„rnnrcnci:,ti,ut of the drrec•lor• or stet tlt,• nurttc•r I~,n ht•arin~; pursuant ttt Secliun 16'3.07 it. t~"•nl\ nn,• t_'II cl:n•n (ullu\crnt; suhnllaclr,tt of NFING t IGxrM: the director's recommendation, r:eventy five t751 x:rcent of the owrtcrs of the sera initially peti- tioned appeal the director's recommendation by filing with the director a petition for rcrorisiderntion. Sec. 168.05. Folknv-up investi{;alic-n. IC the initial invccti{;ation indioatos th;u seri- ous problems may exist in the residential :erca because of nonresidential parkin{(, the director shall conduct a more thorough investigation to determine the teasibi{ity of residential permit par•k• ing for that or related areas. This investigation may include, but shall not be limited to, observa• lions, surveys, studies or any other data-gathering method which will assist the director in making a recommendation regarding the designation of a residential permit parking area. Sec. 168.06. Recommendation to the city council. After analysing the results of the more thot•• ough in\•estiigation, and after considering anc rele~ want material submitted by the parking commis• Sion or any other person or group having an in- terest in the establishment of a residential permit parking program for that area, the director shall submit the results of his investigation and shall issue a written report recommending to the coun• cil the rejection or designation of a specific resi• dentist permit parking area. If the director rec• ommends rejection of the petition, appeals may he taken in a manner :LS provided in Scrtion Iii$.0-l. If the director recommends the designation of :t residential permit parking area, said recommen- dation shalt: 1) State, \eith p:-rticul:tlit}•, the residential :u•t:a to be included, but rfe~~d nut bt• the s:unc u'ca proposed in the pt~tilion; t''1 Matt: t;Ilict~•linr:; for tleterntinin,; \\'hc, :nn~ ul,t:un rr~ul~•nUul parkin;; tc,•r•ntits :uu! th,. nu•thcxl ul• uht:Iintny; these 3„vnrit~ :1~ lu•„ ridcd in tieclic,n 1Gt+.lU; 1:31 Include wch other era onitble conditions as to m;-ke the residential permit parkinf; pro(;r,un fair and \\•orkal>le 1'~I1 i ATTACHMENT E-6 tart n: Scc. !6!3.07. Hcarin~-. Upon receipt of the recommendation of the di~rector to implement a residential parkin6• permitprogram, or• upon submia•~ion ofn proper and timely1plxalasapp-•uvcd -n Section 1t33.Od, they rnuneilshall •c•t a 1inr~• anct t,lacc fi-r aih,• tw~titinn. At Iran ten 110) dti~ hirring~,n, he:u'irtl;. no[icr shall t-e .~ y Prior to the brven by publication intheofficialpaperendbywrittennoticetoalldistrictcouncils. At least ten (10) days prior tothehcar•irtb•. notice s)t:tll also be served by mailonthepersonmakingthecertificaterequiredbySection168.03(e). No other notice shall be required.At the hearing, the council shall hear all inter-ested persons and shall receive and consider ellmaterialsrelevanttothemeritsofthepetition. Sea 168.08. E a) J"f the council therea M~,. dentist fter deems such a real-Permit parking Program pecessary, thevlatilDtt °~tb~or'ise!d ~' Seetiortftatrthetiasirsforthecreation o~f~gh~ es~~ ~~permit parking area which basis sypporis the ex•tr3+><ce of the foilo~ving or other sergous problemst+sed by nonresidential parking:.. 1) 1~he area is detrimentally impacted by park-ing of commuter vehicles during the pro-posed hours of restriction and that this det-rimental impact creates an unreasonableincreaseinhazardousu'a0'ic eohditiona; and2) The area does not have sutticilent parkingtoaccommodatetheconvenientparkingofautumobiie~s by resndents thereof in the vi-cinity of their homes; and f3) &•reet cleaning, snow removal! and othercleanupoperationsaregreatly! hamperedbythepresentunregulatedparking; and1) The restriction of on•street parking avail-nhlr In cc-mmut~•rs will r~alucc vehicle noise,itnl)trtian• cnngrstictn and other advrrsr~tt'c-rtina•ulvl ~~lT~•cts of at-trtr»obilep contmut-ttu^I,•td ~~ ill thu: ~•ncnural,~C reliance un car1andnt;t;. trartsil: a-td t;'i) The hr;+lth. :eti•ty, •+~rlfare ;urd int.et,•-•it~• orthrrc.-de*ntc. thrr r~•.itlcnli~l ~re.~ and thecitya..• :r u•lrolr. and thr :,ttr:-et,veness and LMaa~LAT1v~: ('ttlJg livahiilitytof the mighbtrrh~ K.iil he Ixt-ter protected by n Fystem ofresident i,•-1park-ing under Lhis chapter. SCC. 1fiN.08, I'urking permits authorizrcl.Thr r,:,,tlution dc.it;natinl,• and rstablishinl; :,residential permit parkin!; are:, shall provide fi-rtheissu:,nce of annual parking permits to resi-dents ofsuch area subjext to the folluw•ing 6nridefines;I) 1'he director shall identify the designatedlocation, hours and number of streets to beregulatedwithintheresidentialparkingpermitareaasprovidedherein.2) An aPPlicatipn for anyone or more of thepermitsprovidedinSection168.10(a) shallbeonaformrecommendedbythedirectorand, where aPProPriate, shall contain thenameandadidressoftheapplieant, make,model and incense .number of the vehicleandanyaddi~iona! information which willaidintheenforcementoftheprovisionsofthischapter. No person shall furnish falseinformationinanapplicationforavehiclepermit. A !slag application shat! be groutuisfordenialorrevocationofthepermitandispunishableasamisdemeanor. 3) ~ mm:mum =wtuefundable p~of ~' dd~rs K10.OA) shall be chforeachresidentialandtransferable visi-tor permit to cover costs incurred as a re•suit of the implementation of a residentialpermitparkingplan. 4) __ be placed in the •~s shat! J~3' vehicle. ~-~ecia! -`the' tidr~,..b•",t ~ _, wit m~s~ j'ery'!'1y'~11tt~Cl~icl+Jorsomeotherconspicuuusspotunthefi•untofthevehicletcherethey :+re visibly to thr•enforcement petsonnc•I. Sec. 168.10. Issuance of pcrrnils. a) The follot,•inl; pormil., t.•hich shall br purchased ;tt a location :,, d,•termint•d by' lhe• dir~•c.tor. Shell be rnadC ;,r;rrl:rhlr to pc•r~nrrs c•ntilli•d t<<111) ti r ` ~ ATTACHMENT E-7 1':\Ithl~l: rrcrivr san!~• nndrr this cltaplur, in .uch litrnt and fi-r sut-h dur:tr ir,n :~, dt•ti•rntinr.•tl h~' tht• du•trlwu•: 11 '1'ho rntntlarr of rr>ziltlantistl pnrkinl; tt!•rtnit,~ tr•r rr.idcnrr• ut' {tr•t7 ttutltiJHrliin),; unit shall 1•.• cir•tr•rtrunr•t! In• tll-e dirrtiUtr prut.•idal• that urh i~r•rnrit: >:utlllin• ut:rJt• :+>,•ailahlc• ttnl~• art thc• h;-~r.: t-t et•liiclr•~ +r+~•nctl h~• :u-d r.•}; istt•rt•d to thr rr.illettt!: a•hrt rr:sidc ut rite restricu•d :u~r•a and a•hc: have requested ibis permit; thr• number' of residential parking tcrmits, if an~•, avarlahlc to nwncrs of cony mercial buildings or other occupied slruc- tures not mentioned abo~•e shall be deter' mine) by the director at the time he sub' mils his mcommendation to the council. 2) The number of ar~rt~taferable visitor's per- mits per residence for per multidwelling unit and the number of transferable visitor's permits, if an}•, available to owners of com- mercial buildinss or other occupied struc- tures net mentioned abo~•e shall be deter- mined by the director at the time he sub- mits hi~•recommcndation to the council. 3) Residents tt,ilhitt ~}tte rt:strictea: area, at::: cast c+f onN dollar M!~1}~AtH ~tor each ..permit„ mat' ~•ppl~• to thc• director for nontransfrr- abl•: snd dated tMR•e>sls7trewi {~rmi1F upon a showit-g h~• the residcut that, during the date and hours for which the permit. are to lte issued, the uae of the permit,: shall be for spet:iaF events ~vngistent witch the tresi- ciential cltaracter of the ncig}thonc~tnti-acrd ot.hcr prcrvi~i!tn; of Ia~+•. The dircaat~r ::hall dr•tc•rtninr thr nurtEl><r cd•~~.et:iarl tweet-{x r:• mils tt- be isu~•d land -the hours in ef}~`ct upon his determination the:t the issuHnce of aaut~ :could nc-t undul~• istt{~air tr~flic s:tfcl~. our orate serious 1>rcthlem; during the ~•Itec•ticc period of the Itermit~. 1. (~Itur't'he:: `+'itltitt Ilhr rr~l:'u'1t•:t :u'.•:,. :U :t t.a.•• ••t' nor dull:n• la) tub 1;•r t;a•a Ir,•r:t+it. m:n .!rtlnir,• li'rmt i hr• rltrt•t•-Irr r r:tr.•-ft•• ahir• vltet-r::l ecenl {x~t'npils prttcirlrtl. th::l .unit Itr•r:uit. shall be used only rn cnnjuncli!tn tttlh cctrnls .prutsut'ctl h~ tht• altl,licant Church. 'I•It~• rlrrCCt~r shall dctrrnttnr the nunrher ul• and rfl•ccl!cr Irrriucl ul thr I>cr mrt; tt, he !:•urd tiut•h I>c•rnut: ;hall nt,t he u:r; r~ rr•cp+irt•tl a{tr-n :tch:tttcr ttctluY~ u- LItC enforty. nx•nt ay;tvu•y firr rctr:atrcfinatl• church events such as tiuurrals• mc•ntnrial xc•rric:es• fcsti• vat:: ar hautars ur x•4•clclin~n, where issu• urr~ of such {x•rntits ta•uuld Ixr impractical. rn- 14•t'vtn xlut Ih•rf•a•ttt _ r~_ it iu x•hich {rukin{~ is sc+ nstrictcd~tsetutri• int{xtsc:d by this chap- ter; provided, that their cxentplion tcrmi• Hales immediately upon the completion of services or assistance as herein provided. Nothing in this section is intended to pro' hibit a resident owner of these vehicles from obt<~ining residential parking permits for same in accordance with the provisions of this chapter. b) In the et.•ent any of the permits issued under this chapter are lost, duplicates shall be obtained. from the director at a cost of one dollar ($i.OU) per permit; provided, that no such duplicate shall be issued unless and until the applicant has furnished to the director a tt~riuen statunent under o2th and pr~pcrh nutari:.ed that he oi• she has lost the original permit. 1\o person shall apply for a du• plicate perrnii unless the original permit has, in fact, !>een lo.=l. c) No permits iasued under chit: rhepter shalt gttannt+ee~lor reser.e to Utc holder a particular parkir-g ~e w•itltin the designated area but shall provide general petri¢itttg in said area dfu•ing the time slxcifit.•cl b.• the resulut.iun and so posted a reyuircd in ~cctiun lti3.11. ul~ \rlhin:: hernia shall abru{;atc rho sccgte ui parkin; privileges {;ranlt•d handicapped persons ts cir•finrd is $c•t•ti~~r: l~~i.?U of this Code ar by statut!• of the State of ~~innt~utia. tit's. l/iti•1t.. !'t-ain{; t-f si};ns. 1 ia• rl:r, r! <t! •„ , ;•~. •(Il,t'••ti1 fatr .It;n~ to h. lt~t~t,•~! ::r t!r• r• .. .. •i :uv :r ~ • a: t,. tnturnt :u. 1 ~• . .~,• ,in•;-~•NI n. the t•Xs:ar•.:Ce• nt the rut, ::,:r•i 1, :;:1!..:t•,a:- Heir.'>,••I Ir. th~• rtt~tru t oar tics. I li•.ti. l'Z. 1'rnalt ~'. ll sh:,ll in uttl.icttul (ur :utc prr:uu Iu riulatt• surit rule::uu) n•t;!:!;rttnn~ :\nt• {tt•rstrn cutl:tlin}; parkittl; rt•~trulr~•n~ •u tt,,arrl shall he t:uillY ul•a 1•!t!!t ATTACHMENT E-8 c If..K IY LE(:I~t.AI'i~'F:I~~IUF: misdemeanor and subject w a fine of nul to ex• teed lwenty•fivc dollars (='15.00), Any other viola• lion of f.his chirpier shAll be deemed n misdemeanor and punished andJor Ixxnnlized accurdint,~ly. Chnptcr IG9. Iac.~crvcd The next page is I2G1- 1210 ATTACHMENT E-9 r,;.r t-a f1 Vu)lrrtir~n,• Ix•rrrrlty. Any motor vehicle stopped,parked, abandoned or otherwise Ie(t unattendedinviolationofnrtyprovisionofthischaptershallbedeemedanotlenschereunderandpunishableasamisdcmennar. tCodr IJ,SG, ~ t3;t.07- Ch:-pte•r I (iii. 1':rrking, &•vcnth PIHCC• Scc. 1(ii.0l. Ai:eximum parking timc• Seventh1'I:ccc behvccn Minnesota Streetand .Jackson Street. the lawful parking• tune forparkingotvehiclesonthenorthsideofSeventhPlacefromMinne-sota Street to Jackson Street any day except Sat-urdays and holidays shall be a maximum of two2) hours between the hours of 9:30 e.m. and 5:00p.m. Except for the lawful parking of commercialorservicevehicles, as provided in Section 165.03,parking on the south side of Seventh Place fromMinnesotaStreettoJacksonStreetanydayaCanytimeisabsolutelyprohibited. Sec. 165.02. No p:trk.inb between 2:00 a.nt. znd9:30 a.m.; exception. Except for the Lawful parkin o£cog mmercial orservicevehiclesasprovidedinSection165.03, novehicleshallremai» parked or be parked on thenorthsideofSe~•enth Place from l~nnesota StreettoJacksonStreetbetweenthehoursof2:00 a.m.and 9:30 a.m. Sec. 165.03. Commercial or service vehicles. Only clearly marked commcr•cial or service ve-hicles nt:iy park for a maximum of thirty (30)minutes at places designated as truck loadingzonesbysigns. curbs or sidewalk markings onSeventhPlacefromMinnesotaStreettoJacksonStreetbetweenthehr,urs of 7:00 a.m. and 9:30a.m. P:u•kinl; in thc.e zttrtos shall be for the pur-pu.~r t~f )nadirs;; or ttnluaclirtg mcrchanr}ire antioncetht• u~tt•r:air+rt i. t•nrt~pletc~d r>t• at the end ulthentasintunilinur ~tcrr,rcl of thirty +:JUt nunut.t:~,t~ Itcrt~in I,ru~~i+lt•tl. th~• ~•t•hiclt• shall be rctttovcdfrotl Sec. 165.04. Physically handicapped zones. Physically handicapped pertROri,S as definecJ inSuction159.1? of the Saint Paul Legixiativ~ Cademaypartaioneapacepeerblocknnthem-rth sidrofSeventh1'I:rce between Minnertot.~e and JacksonStreets. which will be desi6-natcd for the solr utscofthephysicallyhandicappedbythetratfrcengi-Weer. Such places shalt be designated and markedbysi6•ns. No person shall park in such spacesunlesstheappropriatehandicappedcertificate,as defined in Section 157.17, is prominently dis-played on the parked vehicle. Parking spaces of-ficially designated for the physically handicappedshallbesubjecttothesamerestrictionsimposedinSections165.01 and 165.02. Sec. 165.05, Violation a misdemeanor. Any vehicle stopped, parked, abandoned or oth-erwise Jett unattended in violation of any provi-sion of this chapter is hereby declared to be anobstructiontothepublicstreetsandshallconsti-tute amisdemeanor. Chapter 166. Residential Permit Parking-`University of Minnesota, St. Paul Campus-andWilliamMitchellCollegeofLaw• '~ Sec. 166.01. Declaration of purpose. The council of the City of Saint Paul finds thattheresidentialareaadjacenttoorneartheUni-versify of Minnesota, Saint Paul Campus doesnothavesufficientotTstreetparkingtosafelyac•commodate the residential parking needs of theresidents, and the parking needs of nonresidentsusingthisinstitution. The council further findsthefrequentparkingofvehiclesinthisresiden-tial area by these nonresidential users has cre-ated residential problems of a safety, crivironnten•tai and aesthetic nature. 1'hc•rcforc, to enrnural;c ~eliancc nn car pool,anti rnasti transit, which is at:hicver• by asurinl;con~•cnic•nt p:trkinl; to rt•,it1c•ntti ~~•ho Iearc their rrt to luachrt4 zone inuttetliately.F.ditar's note-Qrd+nancc ~m_ rf711 and lfiT25,rdoptcdlkt..~3, 1980, r+nJ lY,.lrfiirl as Ch 166, covcnnt: substaetiallyF:rtitur's nut<•-'I'hn chair„.r +n rr.•r+v~gl (rum Urd \n , the same subject matter ns m ties chapter, expired b)• theiradopri•d f)rr 5. 1!+; ~. lt;•fS~, Icrms on tkc t, t9Kt, $,rtruns rt;tiuul (i. •! \'.. 171a? ,,,h,l,r,•d At:,.' 10. 01 through 166.r8gbpvc19 ~ arc from Ord. \„ I70J:1, nJvy+rJ Ju:'y 11, 198J, and eticrtweAult. Yl, 19R;1 l20U 4 ATTACHMENT E-11 r -. . i'.~ K ti 1V(:u~rc.ua cars at home florin]; the drty, to enhance the qual- ity of life in residential urertr; by rrducing noise, trutrc hnutrds and litter, to reduce air pollution and other en~•ironroentai fnclors; of excessive au- lomobilr c•untnrutin~;. and to prescrrvc the srttely of chilrlri•n and other lx:dc•sU•itrns, w-d Lhe r~~~- dcntial :u•tr;- li•r,rn thr• :rltr-vr•mr•ntu-nF'd health and vrfct}• haz:u•<I~, tltc c•r,unc•il of the (;it}' of S:-int Paul hereby c~tablishrs lhi:: Rc~.identi.rl Prrmil l .•trking Ordinance (.Sc.•ctions 166.01 through 166.08) Sec. I6G.0'l. ]tc;stricied residential permit p~rk- ing areas authorized. The follo:.•ing parking regulations shall be in effect in the residential area in and around the University of Minnesota, Saint Pau! Campus: 1) Except by permit or unless otherwise post- ed, one-hour parking weekdays Crom 8:00 a.m. to 5:00 p.m. on the following streets: South side of Hoyt from Fulham Street to the alley east of Grantham. Both sides of Dttdley Avenue from Grantham Street to Hythe Street. I`'orth side of Dudley Avenue from Hythe Street to Cleveland Avenue. Both sides of Hendon Avenue from Fulham Street to Hythc Street. North side of Hendon Avenue from Hythe Street to Cleveland Avenue. North side of Buford A~•enue from Grantham Street to Hythe Street. South side of Buford Avenue from Lhree hundred (300) feel east of Grantham Street to alle}• west of Cleveland Avenue. North side of Dctswcll Avenue from one hun- dred fifty (1501 fret cast of Como Avenue to Clc•~•cland A~rnuc. uuth side of 1)rra~•cll Avenue front Gu~•e I'I:u•c to C'hclitr~furd Street. Kurth side of C:u•ter Avenue from the :tllc~• cast of Cumo Avr:nue to the Chelmsford Street. South side of ~;:rrter Avenue from the alley cast of Cumo Avenue to Cleveland Avenue. North side of Commonwealth Avenue from the aNey earl of Como Avenue tct Clcve- land Avenue. - - North iidc of 1Cnapp Street from Utc alh•y east of Coma Avenue to Cleveland :~cr•nnc. I::ca .idc of Fulh:un Street from h~•r- bun dred lift}• ('~i~01 ti•ct south of Ilcndun ~~~•e• nue north to Eiuyt Avenue. West sidee of Fulham Stre(~t from the alley north of Como Avenue to Hendon Avenue. Both sides of Branston Street from Hoyt Avenue to the dead end three hundred (300) feet south of Iiendon. Boih sides of Grantham Street from Hoyt Avenue to Doswell Avenue. Bath sides of Chelmsford Street from Dud• ley Avenue to Carter Avenue. West side of Chelmsford Street from Car• ter Avenue to Knapp Street. Both sides of Hythe Street from Dudley Avenue to Buford Avenue. tVest side of Hythe Street from Buford Av• enue to Doswell Avenue. West side of Raymond Avenue from Dud• ley Avenue to Scudder Street. North side of Scudder from the alley east of Como Avenue to Cleveland Avenue. West side of Cleveland Avenue from Scud• der Street to Buford Avenue. 2) Fifteen•minute parking by residents or non- residents from 8:00 a.m. to 6:00 p.nt. on the south side of Buford Avenue front Cleve- land Avenue ~~•est to the alley. Sec. 166.03. Parkin}; permits; elit,~bilit}•; icsu• uu•c•. tar a/rp/rrutr~,rr Annual r-pplication firr un~ ur morn p:crkinr; !x•rnut~ authorized undrr Srrtiun; 166.U1 through 1(;G U;i shall br mndr on :, form provided by the dire~U>r of the deparlntent of pub• lie works, hereinafter referred to as "director." N•hich form may rcyuirc the applicant to furnish his or her Warne ;tnd address, rnnke, model and 1101. ATTACHME:~'T E-12 afi rr,-; n:~ Lcenxe numlt~•r of his or her vehiclex, and anyadditionalinfonnatiortwhichwillaidth~~ directorintlrccnforccrnerrtoftltcraelrovisions. b). Annual ~xrnrit ap~~lic»ti~q ja• A nonrefund•able annual permit applicntinn•fce of ten dollars10.001 for, c.u ft rca'ulr•nttnl p,rrkint; (xrnrrt xh;illberequire,( to r,rvcr rnxts inrurrcd :rs :r ret;ult oftht: intplemrnt:rUort of the rer;identi;-1 permit park,inti plan. c) Nunrbcr ojper-uits. An unlimited number ofresidentialparkingpermitsshallbemadeavail,able to the resident of said residence or dwellingunitonthebasisofonepermitforeachvehicleownedbytheresident. In no way shall the num-ber ofpermits exceed the number of vehicles ownedbytheresident. d) Visitor permits. Unlimited transferable vis-itor permits, at a nonrefundable annual cost oftendollars ($10.00) per permit, shall be madeavailabletoeachresidenceordwellingunit, not,withstanding whether or not the resident oC theresidenceordwellingunitownsanautomobile.Provided that na resident of a residence or dwell-ing unit may use a visitor pet•mit to park a carvnedorcontrolledbyhimorherintherestrictedarea, it being the intent of Sections 166.02 through166.08 that such visitor permits shall be madeavailableandusedbypeoplenotresidinginbutvisitingaresidentoftherestrictedarea. e) Residents, special euerr! permits. Residentswithintherestrictedarea, at a cost of one dollar31.00) for each permit, may acquire Crom thedirectornontransferableanddatedspecialeventpermitswhichshallstatetheexpirationdateofsaidpermits. The director, shall determine thenumberofspecialeventpermitstobeissuedandthehoursineffect, upon his determination thattheissuanceofsamewouldnotundulyirnpairtrafficsafetyorcreateseriousproblemsdurinl;the use of such special permits, n Churchc.S stxrieil c•c•,•nt !><rnri[s: e:tctntiorts,~ n.>-ticr. Churches within the restricted area, :tt a costofonedollar (S1.UOt for each permit, may acquirefrontthedirectortransferablespecialeventper.mils; provided that such permits shall be usedonlyinconjunctionwitheventssponsoredbytheapplicantchurch. The director shall determine the number of end cffecti~•c pericxl of the permitstobeiwqued. Stich permits rshall not be required,upon ndvnnce notice to thr• prtlicc deparlmenl, forextraordinarychurcheventsxuchasfuner:rlx, me•morial ecrviccrr, fr•xt ivalx nr ba~.;rars; or wcJrlinl,~x,where ix.•;unnrr rJsuch 1M•rmita ~t•ould Ire intpr;-r•tic,•rblc. 1 17nrrnrrnt u(t,<•rnrrt stickers ur tirk,•tx ~Itesi•dential parking permit stickers shall ire placed inthelowerrearcorneroftheleftsidewindowclos-est to the rear of the vehicle. Visitor and specialeventpermitticketsshallbeplacedoverthepostholdingtherearviewmirrortothewindshieldorsomeotherconspicuousspotonthefrontofthevehiclewheretheyarevisibletotheenforcementpersonnel. h) Ptrmit dots not reserve parking apnee NopermitissuedunderSections166.01 through 166.08shallguaranteeorreservetotheholderapartic-ular parking space within the restricted area butshallprovidegeneralparkinginsaidareaduringthetimespecifiedinSection166.02 and so postedasrequiredbySection166.07. i) Lost permits; duplicates. In the event any ofthepermitsissuedundertheseprovisionsislost,duplicates shall be ohtained from the director at acostofonedollar (=1.00) per permit; provided,that no such duplicate shall be issued unless anduntiltheapplicanthasfurnishedtothedirectorawrittenstatementthatheorshehaslosttheoriginalpermit. No person shall apply fora du-plicate permit unless the original permit has infactbeenlost. Sec. 166.04. Services, repair and entert;cncyassistance. Individuals «•ho perGtnn or vehicles used in t hrperformanceofcornmcrci:rl ~crvi~r~s. rcpairc ~r• emergency as.iaanre titr ;utv rr.ident li~•inp; inthere.idential area are,~xempt front rc+tr-icli~n:irnposed under S._•c•lion. 16G.t-I thrnu~;h lfit;.(1.~;provided, that such 1-e•rauns are then pcrfitrnrinl;or the vehic•Ie~ in fact are lhcn Irein;; ukd in .u~•hservicesor :rssi5tanrc: ;end pr~~ridt•d further, thatthee:cernptirm I,•r;tnt,Yl hrrcurrclw slr»I1 krminalcimm~•dial.ely u(ron cumlr-~•Uon u(~ the nrces.~ary acevicesorassistance. 1 ZI).~. N ATTACHMENT E-13 z 1'AHIiIX(~ Src. lGf-.Oi. titrcct mainlcnancc; snow cmcr• t;cncy. No exeml~tiona or other permits 6-ranted herein gh:rll al,rof;atc the scope of pnrkinl; restrictions imlx-s~d :+• such restrictions relate to street mnin• tcnancc, h:u•kin~; in one location lx~yund twenty- fi-ur tl•1- h,nrr., ur cnrrr~;rncics pr•u~•idcd in Chal>- Icr 1(il. c. if>fi.OG. Hundia~pped parking. I~'e,thing herein provided shall abrogate the scope of parking pri~•ileges granted handicapped persons as established pursuant to this code or statutes enacted by this state. Sec. 16G.07. Posting of signs. The director shall cause appropriate signs to be posted in the restricted areas so as to inform an ordinarily observant person of the existence of rules and regulations imposed by these provisions. Sec. 166.08. Penalty. It shall be unlawful Cor any person to submit false information in any application for a parking permit issued pursuant to Sections 166.01 through 166.08. Violation of any application requirement shall be grounds Cor denial or revocation of the permit and shall be punishable as a misdemean- or. IL shall also be unlawful for any vehicle to be stopped, parked or abandoned in violation of these provisions. Any such violation is hereby declared an obstruction of public streets and I;ha11 be pun- ishable as a misdemeanor and may subject the vehicle to be moved or impounded at the cost and expense of the owner in accordance with the terms of Chapter 162. Sec. 1GG.09. Reserved.' Scc•. 1 Gfi. 2 0. I2ese rued. S+•c•. lti1>.I 1. Ihclar:rtian of irurposc. The c+xurcil of the Cily of Saint Paul finds that the r~rsidentia) area adj:+cent to ur near the Wil- li:+nt Mitchell Cullcl;e of l,a~.• does not have suffi• lute-tic~• the .tl~+ur's note ay~.a•nded to the chapter title of Ihi~ chw+M~•r E Ire: 1•~ cieM oR-street parking tv snfrly a~ocommodate the residential parking needs of the residents, and the parking needs of nanresidcnts using this in• stitution. The council further finds~ihc frequent parking of vehicles in Lhis residential.arch by theSC nonresiidenliat utters hac created~residential prohlen~ of a safety, envirnnnrent:r! aril sie.~thetie nnturc. Therefore to encourage reliance on car ixxrl. and mass transit, which is nc}rieved by assurinf; convenient parking to residents who leave their cars at home during the day, to enhance the qual- ity of life in residential areas by reducing noise, traffic hazards and litter, to reduce air pollution and other environmental factors of excessive au• tomobile commuting, and to preserve the safety of children and other pedestrians, and the resi- dential area from the above-mentioned health and safety hazards, the council of the City of Saint Paul hereby establishes this residential Permit Parking Ordinance (Sections 166.11 through 166.18). Sec. lfi6.12. Restricted residential permit park- ing areas authorized. The following parking regulations shall be in effect in the residential area in and around the William Mitchell College of Law: 1) Except by permit or unless otherwise post- ed, no parking from 2:00 p.m. to 8:00 p.m. on the north side of Portland Avenue be• tween Victoria Street and Milton Street. 2) Except by permit or unless otherwise post- ed, one-hour parking weekdays from 2:00 p.m. to 8:30 p.m. on the following streets: North side of Portland Avenue between Vic- toria Street and Avon Street. Both sides of Portland Avenue bet~reen Mil- ton Street and Chats~~•orih Street. South side of Nolly A~•enur bet~~•.~en Victo ria $trctil and A~•on Slrtrt. West side of Milton Avenur front }'c+rtland Avenue south to the alley. 3) 1f, during the cffectirc period of this non resident parking ordinance, demand shifts to streets outside of the established permit. 1203 ATTACHMENT E-14 t•"c c CI'CY OF SAINT PAUL CormciiWt . rc~Ow Fii! N0. Ordinance - O~ai~.~ No. nted By Referred ro Committee: Dace Out of Committee By Date An Ordinance clarifying the placement of permit parking stickers or tickets pursuant to Chapter 166 and 168 of the Saint Paul Legislative Code. THE COUNCIL OF .THE CITY OF SAINT PAUL DOES ORDAIN: Section 1. That section 166.03(8) of the Saint Paul Legislative Code be amended to read as follows: 166.03(8). Placement of permit stickers or tickets. Residential parking permit stickers shall be plaeed erma- nently affixed to the outside of the vehicle in the lower rear corner of the left side window closest to the rear of the vehicle. Visitor and special event permit stickers shall be placed over the post holding the rear view mirror to the windshield or some other .conspicuous spot on the front of the vehicle where they are'visible to the enforce- ment personnel. Section 2. That section 166.13(8) of the Saint Paul Legislative Code be amended to read as follows: 166.13(8). Placement permit stickers or tickets. Residential parking perms sti keys shall be p~aeed erma- nentl affixed to the tsid of the vehicle in the lower rear corner of the lei de window closest to the rear of the vehicle. Visitor and special event permit stickers shall be placed over the post holding the rear view mirror to the windshield or some other conspicuous spot on the f runt of thr• vPhi rl P r.rhPrP thrau, nrP of cihl P to the p*'+fC]rCe courrc~~MFN Yeas Nays O~.w Nioetia Itettw~ae+ tC!-~ibd Son•wn TcdKCo wciwn lldopted by Council n Favor Against Date CcniGcd Passed by Co~nnl Secretary t3y Approved by Mayor: Date Requested by Depactaent of: BY Focm Approved by City Attorney By Approved br a Sobwissior+ to Cotur~cit s~'••O" ~ ~• a a v r' JA j N'l YA U LATTACHMENTE-15 Rlk•~..NO. rdtnance ~~„~ H 0. rcsented By Reterrcd To Committte:Date Out of Committte By Date ment personnel. Section 3. That section 168.09(4) of the Saint Paul Legislative Codebeamendedtoreadasfollows: 168.09(4). Placement of permit stickers or tickets.Residential parking permit stickers shall benentlaffixedtotheoutsideofthevehiclein~the lowerrearcornerotheletsidewindowclosesttothe-rearofthevehicle. Visitor and special-event permit stickersshallbeplacedoverthepostholdingtherearviewmirrortothewindshieldorsomeotherconspicuousspotonthefrontofthevehiclewheretheyarevisibletotheenforcemmentpersonnel. Section 4. This ordinance shall take effect and be in force thirtydaysfromandafteritspassage, approval and publication. C,e~ s~~ S s r~eS fa tom 41r owMCS,~~,'' . A~OS. iv ~,,~c~s~nF,~ 2. COUNCILAtFN Yess Nays a... Nioe~ ... ,p Ia Fatror11~etwww ss"'~.t-~ ~ ~. Againsttt:~ T~dnoe. :.i:~ , ' KiNow r.' Ado ted bf' Coue~cil t'., DateCe~d Passed by ,Council Secrete ry s~ .i5`i ti° .8y K L~1,'~.. 3 . A roved ~.~ ..PP bti Its~ror, .Date Requested by Dep=rta~ent oi: ey Fore Approved by City Attorney By Approved by Mayot for Subn-ission to Council A ev Consent Policx=_CITY OF lALCON HEIGBTS r BEQUEST lOR COUNCIL CONSIDERATION Agenda Item: F 2 Meeting Date: 4121/88 ITEM DESCRIPTION: Larpenteur-Prior-Gortner SUBMITTED BY: .Jan Wiejssner REVIENED BY: Copies. senlt out to representatives of University of Minnesota,Hewlett,Pa~kard, Falcon Heights Fire Depafrtment ERPLANATION/SUMMARY (attach additional sheets as neces'{arp): pp~- ~'~'"'~ 1~e~txD~~ ACTION REQUESTED: '' Reconsider City's preferred option. ""' `--W'~~ ~~~ On August 10, 1488, the', City Council discussed Ramsey County's Feasibility StudyfortheLarpenteur-PriorGortner intersection. At that time, the Council expressapreferencefortheoptionrequiringtherealignmentbfGortnertoPriorbutwantedaformalresponsefromtheUniversityofMinnesotaregardingtheuseoftheirlandforthispurpose. Attached is a letter from Clint Hewitt to Ken Weltzin stating the University ofMinnesota's position as ',well as an earlier letter from'; Harvey Turner. Please bring your copy ~f the County's Feasibility Study to the meeting.f~ VI ~y ~ w ~.C~ ~-~. S~~ QA,W ~ld''ET~~.~. ~O . _I~,Q yl'~Q,l~. ~~V,`'` l5ti1 UNIVERSITY OF MINNESOTA TWIN CITIES August 24, 1988 Janet R. Wiessner Clerk Administrator City of Falcon Heights City Hall, 2077 W. Larpenteur Falcon Heights, Minnesota 55113 Dear Ms. Wiessner: Physical Planning 503 Morrill Hall 100 Church Street S.E. Minneapolis, Minnesota 55455 612)624-5765 I appreciated the opportunity to meet with you again. Our discussion aboutsignalizingtheLarpenteur/Gortner intersection was enlightening. OrlynMillerwillmeetwiththeLandUtilizationCommitteetodaytopresenttheCounty's report. Subsequent to the committee's review, Clinton N. Hewitt,Associate Vice President for Physical Planning, will respond to the desirefortheUniversitytoformallyexpressitsneeds. I also appreciated the chance to talk about other potential issues, and how we can, through our joint efforts, establish a productive working rela- tionship. For your information, Sandra Musso is the Director of SportsFacilitiesandhertelephonenumberis624-2868. I suggest you might wish to talk with Roy Tutt first about the potential for joint programs. Roy is an Assistant Director of Recreational Sports and his number is 633-5216.On matters related to the park or any other land the City is leasing from the University, you need to contact Sue Weinberg who is the Coordinator of Real Estate. You can reach her at 625-4539. On questions related to the expansion of the park, I believe Sue will involve us and I think she will also want to have a review by the Land Utilization Committee. I have begunaninvestigationwithintheUniversitytodetermineifwehaveaneedfor the office space adjacent to City Hall. The Agricultural Extension Service may be looking for space. For future reference, Michaeleen Fox is the Assistant Director of Space Programming and Management. Her number is 624-7079. Under separate cover, ? will se the information and reports you is one wa now. and the ma.jorit t e east side of campus, I feel any impac on even the p.m. pea tion. Respectfully yours, Harve L. Turner PyAIC Assistant Director of Planning HLT:mja nd you, ei requested of parki that this coinsa ther for your files or on loan, on the Transitway. Since Buford g is and will continue to be on modification will have little if e arpen eur~rtnerntersec- Office o/the Associate Vice President L7~UNIVERSITY OF MINNESOTA TWIN CITIES Physical Planning 340 Morrill Hal( 100 Church Street S.E. Minneapolis, Minnesota 55455 612)625-7355 September 13, 1988 Kenneth E. Weltzin Ramsey County Engineew and Director of Public Works Suite 270 350 St. Peter Street St, Paul, Minnesota. 55102 Dear Mr, Weltzin: The University of Minnesota Physical Planning Office has received theFeasibilityReportforGeometricsandTrafficSignalsforLarpenteurAvenue" prepared by the Ramsey County Public Works Department. The reporthasbeencarefullyreviewedbyPhysicalPlanningstaffandtheLandUtili-zation Committee, on the St. Paul Campus. The University has a legitimate interest in maintaining and protecting cam- pus access from the north and is supportive of efforts to improve trafficflowandincreasesafetyonLarpenteurAvenue. The Land Utilization Committee has concluded, however, that realignment of Gortner Avenu to meet Prior Avenue, as recommended in the repor is not an acceptabl ast~erna ive. ea ignment of Gortner would encroac into a jacen exper~ enta plot fields which are valuable external research laboratories,and not simply undeveloped land, Such encroachment would interrupt and destroy nearly thirty years of experimental history, Furthermore, sinceGortner/Larpenteur intersection currently satisfies the warrants forsignalsandthePrior/Larpenteur intersection does not, there appears to benocompellingreasontoabandontheGortnerintersectioninordertoimprovetheintersectionatPrior, Because Gortner Avenue is the only access to the campus from the north, theUniversityalsoopposesanintersectionmodif' ion which woul result in additiona res~ri_~t~ons_, inc u ing elimination o left turns toand~ro arpen eur Avenue, to that access. Restrictions on left turnswouldnotonlyreduceconvenientautomobileaccess, but would alsoseriouslyinhibitthemovementoffarmequipmenttoandfromexperimentalplotlandslocatednorthofLarpenteurAvenue. In the mutual interest of safety, the University supports signalization oftheGortner/Larpenteur intersection and associated turn lane improvementswithinatime. frame considered appropriate by Ramsey County. RecognizingthedesireoftheCityofFalconHeightstosignalizethePrior/Larpenteurintersection, the University would not be opposed to the installation of Kenneth E. Weltzin September 13, 1988 Page 2 an interconnected, coordinated signal system at both intersections if andwhentrafficsafetyalsowarrantsthematPriorAvenue. We appreciate the opportunity to respond to the recommendations of thefeasibilityreportandtoparticipateinthisplanningprocess. Sincerely Clinton N. Hewitt Associate Vice President Physical Planning CNH:mja cc: Carol Campbell Dave Davis Harvey Turner Larry Anderson Warren Schaber Janet Weisner MINUTES REGULAR CITY COUNCIL MEETING AUGUST 10, 1988 Baldwin called the meeting to order at. 7:00 P.M. ALL MEMBERS PRESENT Wallin, Bush, Cernia, P. Chenoweth, and Baldwin. Also presentwereMaurerandS. Chenoweth. CONSENT AGENDA APPROVED Council approved the following consent agenda as presented: 1. Fire/Rescue Reports 2. Disbursements a. General Disbursements through August 10, 1988,45,611.72 b. Payroll 7/16/88 - 7/31/88, $8,672.413. Commission Minutes a. Park & Recreation Minutes of July il, 1988b. Solid Waste commission Minutes of July 20, 1988c. Planning Commission Minutes of August 1, 19884. Appointment of Joseph Olson to Fire Department5. Licenses 6. Appointment of Michael Haglund to Solid WasteCommission FEASIBILITY STUDY ON SIGATALIZATION AT LARPENTEUR/PRIOR/GORTNER Baldwin presented background on the previous meetings over thelasttwoandahalfyearswithHewlettPackard, and theUniversityofMinnesotaregardingthetraffichazardsat theintersectionofLarpenteur/Prior/Gortner, anal the fact that theUniversityisopposedtotheuseofanytestplotareaforrealignmentofGortnerandPrior. Council reviewed thefeasibilitystudypreparedbyRamseyCounty (a copy of which isonfileintheclerk's office) and discussed the possibleoptionsgiveninthatstudy. In reply to an inquiry from Council members regarding whether oriottheUniversityofMinnesotahaddevelopedalternateplansastheyhadsuggestedmightbedone, ORLYN MILLER, UNIVERSITY OFMINNESOTAPLANNING, replied that they had prepared no specificplans, but they wanted to improve access from all areas.Baldwin commented on the fact that the University has beenconsideringclosingBufordatClevelandwhichwouldaddanother1,600 vehicles per day entering and exiting from the remainingopenstreets. Miller was of the opinion that at least half ofthevehicleswouldfunneltothesouthnottoGortner. BaldwinstatedthatanyoftheseproposedchangeswouldimpacttheCity's decision and he was very concerned regarding futureUniversityplanswhichmightaffecttheintersectionatGortnerandLarpenteur. MINUTES AUGUST 10, 1988 PAGE 2 DAN SOLER, RAMSEY COUNTY, Project Engineer for theimprovement, indicated he had not heard of the Bufordoclosang,but if so, it would certainly impact the use of Gortner. HeexplainedthatasignaliswarrantedatGortneratthepresenttime; however, a signal at Prior would not be warranted and theCountycouldnotparticipateinthecostofsignalizationatPriorandLarpenteur. Miller informed Council that coordinatedsignalizationatPrior/Larpenteur and Gortner/Larpenteur wouldbemostacceptabletotheUniversity. JOE MICHAELS, representing St. Anthony Park District 12, statedtheyareworkingwiththeUniversityonatransitprojectandthatareportwrittenin1978recommendedCarter, Buford andGortnerbeclosed. Gortner would then be replaced and realignedwithanotheraccessgoingthroughtheUniversityfieldtestplots. He felt City Officials should be aware of this 1978report . DON HAMILTON, HEWLETT PACKARD, commented on the many years thattheyhaveparticipatedindiscussionstosolvethesafetyproblem, and explained that their firm is sales oriented andtheywouldbeopposedtoanyplanrequiringtheclosingoftheirdrivewayaccess. In response to an inquiry from Chenoweth, asking whether or notanywrittenreporthadbeenpreparedontheUniversity's standonthesituation, Miller explained that there is no writtenreport, however, it has been reviewed by advisory committeesandpresentedtoCentralAdministrationwhoapprovedtheCommittees' position. Ciernia felt that it was prudent toobtainawrittenresponsefromtheUniversityandinformation onfutureplanspriortoCouncilmakinganyfinaldecisions. COUNCIL APPROVES FEASIBILITY STUDY THROUGH ALTERNATE 3 Ciernia moved approval of the Larpenteur/Gortner/PriorFeasibilityStudystipulatingthatRamseyCounty's recommendedAlter~.ate No. 3 is also considered the Council's best solutionandthatso~ut;on wi?1 be pursued. Motioa carried unanimously.Council then directed Wiessner to contact Harvey Turner,University of iriinnesota, to obtain a formal response, and tomeetwithhimanddiscussthesituation. Wiessner is also torequestanyinformationontheUniversity's long range plans.The matter will be discussed further at the August 24, 1988meeting. STATUS REPORT ON HAMLINE ALLEY (SOUTH OF LARPENTEUR RUNNING FROMALBERTTOHAMLINE) Baldwin explained that he had been contacted by severalneighborsabuttingthealleyexpressingconcernthatthe tar didnotsetupafterthesealcoatinganddisappointmentinthegeneralappearanceofthealleyfollowingreconstructionin1986. Maurer reviewed his letter of August 4, 1988, (a copy ofwhichisonfileintheclerk's office) explaining that in hisopinion, ~ it was economically impossible to tear up the alleyandstartoverandthatthecorrectiveactiontakenprovidesthebestoverallsolutiontotheproblem. Consant Meetins~ Date:9/28/88 Policy R F-3CITYOFFALCONHEIGHTSAgendaItem: EQUEST FOR COUNCIL CONSIDERATION ITEM DESCRIPTION: Request for removal olE temporary "No Parking" signs !from St. Mary's Street SUBMITTED BY: Walter and Barbara McCoy, 1746 St. Mary's Street REVIEWED BY: Shirley Chenoweth EXPLANATION/SUMMARY {alttach additional sheets as necessary): a) Request from Mr. ',and Mrs. McCoy b) Copies of Council P4inutes authorizing placement; of the "No Parking"signs NOTE: As of September 23, 1988, Ciatti's.has.leased'i25 parking spaces fromBucks. They ante still trying. to lease an add~.tional 25 fromButchHermes. " 15 Boulevard 25 Buck's 40 Total Added ACTION REQUESTED: ~`',,( y-!( Approve/disapprove ~~ _tvo 6/29/87 c~ -~/-~8 U t.ec~~~-~..,~ 3°u~' as ~` a 7~~La.~.~~,r1 lug. , ~~ ~,~ .~e~1~ ,~u .Cc~- ~ ~f /11~'`~'' J ~- f-- Lc~x~-~~~_~ . a_.~-c- ~ ~.le~ ~vc.c.4~ G,l ~., e-~~ ~,t~~ ~~ J le S~/a -a ~-o/ MINUTES REGULAR CITY COUNCIL MEETING MARCH 9, 1988 I~ Mayor Baldwin called the meeting to order at 7:00 P M. QLL MEMBERS PRESENT Baldwin, Wallin, Bush, Ciernia, and P. Chenoweth. Also present were Gedde, WiessnerandS. Chenoweth. MINUTES OF FEBRUARY 24, 1988 APPROVED Council approved the Minutes of February 24, 19$8 as corrected. ADDENDUM TO AGENDAS Council added Item E(6), March 7th Planning Commission Minutes, to the Consent AgendaandItemF(10), Parking Problem on St. Mary's Street to the Policy Agenda. CONSENT AGENDA APPROVED Council approved the following Consent Agenda: 1. Fire and Rescue Reports 2. Disbursements a. General Disbursements, $25,087.52 b. Sinking Fund, $783.00 c. Pa}roll, $7,344.70 d. Maier Stewart & Associates Billing 12/27/87 - 1/30/88, $601.403. Appointment of Patricia M. Kosters, 1730 W. Larpenteur, to the HumanRightsCommission, Term to Expire 12/31/904. Reappointment of Tom Montain, 1850 Holton, (Term to Expire 12/31/89)and Robert Gehrz, 2285 Folwell (Term to Expire 12/31/90), to theParksandRecreationCommission 5. Licenses 6. Human Rights Commission Minutes for February I8, 19887. March 7th Planning Commission Minutes S P,+~I14G ~TtOB'i~! ~ iT ~1~ A'B'P`' ~.1KliA'Y' S Y~ ^°~E Planner John Uban presented a proposed amendment to the City's Code relating toparkingregulations (memorandum dated January 17, 1986), and four alternate plansforincreasingparkingforCiatti's Restaurant, 1600 West Larpenteur. CouncilconcurredthatapermanentsolutiontothearkintheabuttingresidentialneighborhoodneedspimmediateoreliefustWbessnerdpresentedtanupdateonthemeetingheldMarch4thwhichwasattendedbyrepresentativesofHarvestStates, Ciatti's, Hermes Center, Buck's Unpainted Furniture, the CityEngineer, and Dennis Smith, representing the St. Maw 's Street residents. She felttheneighboringbusinesseswerewillingtocooperateinatemporarysolutiontothe parking problem but were not interested in providing long range parking for Ciatti's. MINUTES MARCH 9, 1988 PAGE 2 Baldwin stated he had personally observed Ciatti'slengthofSt. Mary's Street and felt there was definitelyeashazardntotthefresidents.He was of the opinion that posting "No Parking" on the west side of the streetmightprovidereliefuntilalongtermsolutioncanbeworkedout. Following adiscussion, Ciernia moved, that the west side of St. MatoMapleKnoll, be posted "No Parking" and the motion carriedtunanimouslyhe alley NO ACTION ON VARIANCE REQUEST FROM VICTORIA MIKELONIS, 2216 FOLWELL Wallin explained that the Planning Commission had taken no action on the matterastheywereunsurewhetherornotavarianceisneeded, and tabled the item untilanopinionhasbeenrenderedbytheCityAttorney. Council deferred the matterawaitingarecommendationfromthePlanningCommission. PUBLIC HEARING ON CONDITIONAL USE REQUEST FOR A PET STORE IN A B-2 DISTRICTSCHEDULEDFOR7:15 P.M., APRIL 13, 1988 (TAMRA A. ROTH) Wallin explained that at the March 7, 1988 meeting the Planning Commission recommendedapprovaloftheconditionalusewiththestipulationthataconditionbeincludedwhichwouldprohibitusingthefacilityasaboardingkennel. Ciernia moved that apublichearingontheconditionaluserequestbescheduledfor7:15 P.M., April 13, 1988.Motion carried unanimously. APPLICATION FOR COMMUNITY DEVELOPME?~'T BLOCK GRAFT FUNDS TO PROVIDE SMOKE DETECTORSFORELDERLYA,'v'D LOh?/MODERATE INCOME HOUSEHOLDS Council briefly discussed the grant application which was initiated by the FireDepartment, and the Department's offer to install the smoke detectors free of charge.Bush moved, seconded by Chenoweth, adoption of Resolution R-88-4. Motion carriedunanimously. Council commended the Fire Marshal and Fire Department for their workontheproject. RESOLUTION R-88-4 A RESOLUTION REQUESTING A COMMUNITY BLOCK GRANT TO PROVIDEEARLYWARNINGSMOKEDETECTORSFORELDERLYANDLOW/MODERATEINCOMEHOUSEHOLDS CLERK ADMINISTRATOR'S AND TREASURER'S BONDS APPROVED Chenoweth moved approval of a $100,000 Treasurer's bond and a $10,000 Clerk Administrator'sbond. Motion carried unanimously. SANITARY SEWER RATES TO BE INCREASED Wiessner recommended the proposed sanitary sewer charge increases be approved andexplainedtheincreasesreflectsteadyincreasesinchargesfromtheMetropolitanWasteControlCommission. It was also recommended that the Municipal Code be amendedtoincludesewerchargesinSection5-15.01 (relating to license, permit, and otherfees), such fees to be reviewed annually. Chenoweth moved adoption of Ordinance88-4 and the motion carried unanimously. MINUTES APRIL 27, 1988 PAGE 3 favor thereof: Ciernia and Baldwin, and the following votedagainstthesame: Bush, Chenoweth, and Wallin. Motion failed. Other proposals discussed were as follows: 1) requiringCiatti's to find an additional 25 to 30 parking slots before theCitywouldproceedwiththeproject, 2) if Ciatti's can produceawrittenagreementthattheyhaveotainedtherequiredparkingspacestherewouldbenofurthercosttoCiatti's other than thedifferencebetweenPlansAandB, otherwise they would pay theremainder, or 3) move ahead with Plan B assessing Ciatti's inconjunctionwithanassessmentagreement. STAFF DIRECTED TO NEGOTIATE ASSESSMENT AGREEMENT WITH CIATTI'S Following further discussion, Chenoweth moved that staff bedirectedtoattempttoreachanassessmentagreementwithCiatti's with a cost sharing ratio of 70$ to Ciatti's and 30$ totheCity. Upon a vote being taken the following voted in favorthereof: Bush, Chenoweth and Wallin, and the following votedagainstthesame. Ciernia and Baldwin, Motion carried. PORARY "NO PARRING" TO BE POSTED ON EAST .SIDE OF ST. MARY'S Bush moved that St. Mary's Street be temporarily posted "NoParking" on the east side north of the alley. Motion carriedunanimously. APPROVAL OF ENGINEERING AGREEMENT WITH MAIER, STEWART & ASSOC. Council briefly discussed the proposed agreement and made somerevisions, after which Chenoweth moved that the. Mayor and ClerkAdministratorbeauthorizedtosigntheagreementasmodified.Motion carried unanimously. ADOPTION OF ORDINANCE N0. 0-88-8 RELATING TO ANIMAL CONTROL Gedde presented the proposed amendment and explained it willupdatethecodeandfees, and incorporates language suggested byDr. Hedges of Brighton Animal Clinic. Chenoweth moved adoptionoftheOrdinancewithchangesasrecommendedbyCouncil. Motioncarriedunanimously. ORDINANCE N0. 0-88-8 AN ORDINANCE AMENDING CHAPTER 5, PART 2, ANDSECTION8-2.03 OF THE CODE OF THE CITY OF FALCONHEIGHTS ADOPTION OF ORDINANCE NO. 0-88-9 RELATING TO PENALTIES FOR CODEVIOLATIONS Ciernia moved adoption of Ordinance 0-88-9 relating to penaltiesforcodeviolationsaspresentedbytheCityAttorney. Motioncarriedunanimously. Consent Meeting Date ~/28/88 olicy X Agon.da Item: F1+CITY OF FALCON HEIGHTS REQUEST FOR COUNCIL CONSIDERATION ITS! DESCRIPTION: Northwest Area Storm Drainage Study Update SUBMITTED BYs Terry, Maurer REVIEWED BY: EXPLANATION/SUMMARY (attach additional sheets as necessary): Terry Maurer will be present to discuss the drainage study. Council shoulddiscussitspositionregardingfuturedevelopmentintheLindigExtensionarea. Property owners have inquired about the process. Bring the previously ,distributed reports (green covers) to the meeting. Ifyouneedanextracopy, .please call. ACTION REQUESTED• t t i i l ~ 6/29/87 Consent Policy g CITY OF FALCON HEIGHTS REQUEBT FOR COUNCIL CON81DEwATiON ITEM DESCRIPTION: Charitable Gambling Jan Wiessner SUBMITTED BY: Mike Thompson, Intern REVIEWED BY: ERPLANATION/SUMMARY (attach additional sheets as necessary): Meeting Date:9/28/88 Agenda Item: F-S At the last Council meeting, staff was directed to research the charitablegamblingissue. Attached is a draft recommended amendment. to our existingordinancewhichwouldallowpull-tabs in the City, making it more consistentwithStateLaw. The City Attorney has not yet seen this draft and may have some insights forus. Some of the key issues to allow City control over the operations are: 1. What are the requirements for licensing a charitable gamblingaorganization? What is a reasonable license feet12. How often should gambling be conducted in Falcon Heights?3. Should charitable gambling be taxed locally?4. The state allows the City to designate ten (10 }percent of the net profitsderivedfromgambling. How should those profits be allocated? To whom?5. .Should the City require an annual audit of all charitable gamblingorganizations? 6vr. Attachments: (a) .Existing Code - Section 5-15.01 b) Proposed Amendment to Section 5-15.01 c) Proposed Amendment to Section 5-16.02 ACTION REQUESTED: ti~~ c ~ 6'd-d`am` ~ ..ten, ~'Q. fi't' w10Kra~1-+k 6/29/87 ATTACHMENT A-1 MUNICIPAL Rh3GUTATIOIZS & LICENSING 5_14.06, 14.07 League of Women alters Senior Citizens Ramsey County League of Local GovernmentsLeagueofCities/~I Watershed Management OrganizationsScouts, etc. 4H Neighborhood Groups (such as the Grove Assn., etc.}55 Alive Mature Driving Class Cable Casmission Developers when presenting to neighbors/resi.d~tsLegislators (town hall meetings, etc.)Youth Service Bureau Roseville Area Schools shall be charged their own prevailing ratesforuseofCityfacilities. 5-14.07 T~-i~ + y 1~ePS a. Sanitary Sewer--Charged Quarterly 1'~€ Item 22.00 Single Family Residential 22.00 Apartments Per Unit 85 Commercial and Industrial per 1000 gallons b. Storm Drainage--Charged Quarterly 3.25/lot Single family and duplex16.25/acre Schools and Institutions 32.50/acre Multiple family residential, churches and governmental buildings65.00/acre Commercial PART 15. RD(~JLATION OF NON-PROFIT ~N! ZATI~t C~,LII~ 15.01 B~ulatior of Nbn-profit Oroa_n~~+;~., c~,~,r,i;., S~ibdivision 1. i]t~f initirns As used in this ordinance the followingtermsshallwean: i 30 MUNICIPAL ~TIATIOIIS AID LICEISSING a. "Active member" means a m~nber who has paid all his/her dues totheorganizationandhasbeenamemberoftheorganizationforatleastsix (6) months. b. "Gambling devices" means those gambling devices known aspaddlewheels" or "tipboards", "pull-tabs" (or "ticloet jars") orapparatususedinconductingraffles. c. "Gambling manager".means a member who bas paid all his/her duestotheorganization, has been a member of the organization for atLeasttwo (2) years, and has been designated by the organization tosupervisetheoperationofgamblingdevicesandtheconductofraffles. d. "Lawful purpose" means: 1. Benefiting persons by enhancing their opportunity forreligiousoredu®tional advanoenaent, by relieving orprotectingthenfromdisease, suffering or distress, bycantrilwtingtotheirphysicalwellbeing. by assisting them inestablishingthemselvesinlifeaswrthyandusefulcitizens,or by increasing their c~anprehensian of and demotion to theprinciplesuponwhichthisnationerasfounded; 2. Initiating, performing or fostering worthy public works orenablingorfurtheringtheerectionormaintenanceofpublicstructures; 3. Lessening the burdens borne by government or voluntarilysupporting, augmenting or supplementing services which government would normally render to the people; or 4. die improving, expanding, maintaining or repairing realpropertyownedorleasedbyanorganization. Lawful purpose" cbes not include the erection or acc~isitionofanyrealproperty, unless the city cau~cil specificallyauthorizestheexpendituresafterfindingthatthepropertywillbeusedexclusivelyforoneormreofthepurposesspeCiiiedinthisclause. e. "Organization" means any fraternal, otrs~r nonprofit organization covered by290.05 subdivision 1, clause (i} or (k}. religious, voeterans, or Minnesota Statutes, Section 31 ATTACHMENT A-3 MUNICIPAL RF~GUtATION & LIC~SING 5-154.01 f. "Paddlewheel" means a wheel narked off into sections containingoneormorenund~ers, and which, after being turned or spun, uses apointerorHarkertoindicatewinningd~anoes. Z!'iis definitionshallnotbeconstruedtoincluderoulettewheels. g. "Profit" means the gross receipts from the operation of gamblingdevicesandtheconductofraffles, less reasonable sums expendedforprizes,. licensing fees, taxes and neintenanoe costs for the'devices. h. "Pulltabs" (or "ticket jars") means a single folded or bandedticketoracard, the face of which is initially covered, or other-wise hidden from view, to conceal a number or set of numbers of asymbolorsetofsymbols. A few of the numbers or symbols out of every set of pulltabs (or ticket jars) will have been designated inadvanceandatrandomasprizewinners. A participant pays a consi-deration to an operator for the opQ~rtunity to obtain a folded orbandedticketora ®rd, view the numbers or symbols on it andpossibleobtainaprizewinningpulltab (or ticket jar). i. "Raffle" means a game in which a participant buys a ticket for achanceataprizewiththewinnerdeterminedbyarandomdrawingtotakeplaceatalocationanddateprintedontheticket. j. "Tipboard" means a board or placard measuring at least twelve 12) inches square, marked off in a grid or columns in which eachsectioncontainsahiddennumberornumbers, or other symbol, which determine the winning chances. 2*riis definition shall not be construed to include punchboards or number jars. Subdivision 2. License. a. Required; eligibility. No person except an organizationlicensedunalerthisordinanceshalloperateagamblingdevice or conduct a raffle. An organization may operate a gambling device ormn8uctaraffleifithasbeeninexistenceforatleastthree (3) years, has at least thirty (30) active members, has a license to operate a gambling device or m~uct a raffle and ceaglies with I~linnesota Statutes, Chapter 349, relating to gambling devises andraffles, and the provisions of this ordinance. b. Term; restriction ~/n frequency of use. Ail licenses issued under this ordinance shall be for one (l) year and shall allow the use of gambling devices on three (3) czlendar days in the license year. For purposes of this ordinanwe, raffle apparatus shall be considered to be used or the raffle occasion conducted on the day in which the drawing takes place and tipboards and paddlewheels shall L~ 32 ATTACHMENT A-4 MUNICIPAL RDGUTATION & LICEI~ING 5-15.01 be considered to be used or the tipboard and/or paddlewheel occasionconductedonanydayinwhichnuabersorc~artees are sold. Anorganizationobtainingalicenseunderthisordirwu~oe shall informtheClerk/Aaninistrator in writing of the dates on wi~ich theorganizationwillconductaraffleorgamblingoccasion, Suchnoticeshallbegivenatleasttwo (2) weeks prior to the date ordatesspecifiedfortheconductoftheraffleorga~obling occasion, c. Display. All licenses issued under this ordinance shall bedisplalredduringthelioanseI+ear at the prenises licensed for theconductofgamblingdevices. d. Authority to inspect licensed preni.ses. The ~oeptanoe of alicenseunc~ r this ordinance shall be deemed to be a consent by theorganizationtoinspectionofthelicensedpremises ~ any policeofficeroranyinspectoroftheCity. Subdivision 3. At~lication for .~ rLr~ a. Any eligible organi~tion desiring to be licensed shall apply induplicatetotheCleristrator. Said application shall besignedunderoathoraffirmationbythegamblingmanagerandshallcontainthefollowinginforationandotherinformationrequiredtrytheClerk/Aaninistrator or the Council: 1. The name, address and telephone number of theorganization. 2. The name, address and tale phone number of the gamblingmanager. 3. A copy of Departrnent of the Treasury, Internal RevenueService, "Return of Organization Exempt from Income Tax," form990, or a comparable form if the organization is required tofiletheformwiththeDepartmentoftheTreasury. 4. A copy of Department of the Treasury. Internal RevenueService, "Exempt Organization Business Income Tax," form 990T,or a comparable form if the organization is required to filetheformwiththeDepartmentoftheTreasury. 5. The annual report required of charitable organizations byMinnesotaStatutes, Section 309.53, provided that an organization that conducts gambling but is exempt fromsubmittingthisreporttotheDepartmentofCamaerceunder .Minnesota Statutes, Section 209.53, subdivision la, shallneverthelesssubmitsuchareportunderthissubdivision; 33 ATTACHMENT A-5 MfUNIQPAL ~1TjON 6 LICFI~SI~ 5_15.01 6. 1°-nY lease agreements required by this ordinance, executedbytheorganizationinregardtopremisesleasedfortheconductofgambling. 7. A Dopy of the borr7 or certificate of insurance which meetstherequirementsofSection9(b). b. The Council shall act upon an application within one hundrer7eighty (180) days from the date of appli®tion, but shall not issuealicenseuntilatleastthirty (30) days after the date of apgli-cation. Subdivision 4. Inv s ~aatinrL *ear~~ ~~ The application referred toanypoliceauthorityfortheirinvesti~tion. ikon receiving thereports, if any. of the police authority. the Council may in itsdiscretiongrantordenytheapplication. Subdivision 5. Lia fee. emirat;~~ ~~e a. The annual lioanse fee for a license required by this ordinanceshallbetwentyfive ($25.00). b. All licenses issued under this ordinance shall expire one yearaftertheirissuance . Subdivision 6. Denial. SLLSpen~inn ar,A Tac~r...n~;.+~1 of li nGp~ pnapplicationforalicenseundertr:is ordinance may be denied or alicenseissuedthisordinancemaybesuspendedorrevokedafternoticeandhearingthereonforanyviolationofMinnesotaStatutesrelatingtogamblingorbingoorforanyviolationofthisordinanceorforotherjustcause. Subdivision 7. Profits profits from the operation of gamblingdevicesortheconductofrafflesshallbeusedsolelyforlawfulPurposesasdefinedhereinandasauthorizedataregularmeeting of theorganization. Subdivision. 8. S~dlu~ina operation a ~~ ;~~ a. No co~ensation in excess of $~25 per Week shall be paid incorrectionWiththeoperationofagamblingdeviceortheconduct ofsrafflebyalicensedorganization. Iib person who is not an activememberofthelicensedorganizationorofitsauxiliaryorthespouseorsurvivingspouseofanactivesembermayparticipateintheorganizationsoperationofagamblingdeviceorconductofaraffle. 34 ATTACHMENT A-6 MUNICIPAL RDGU~~pp ~ I„I~I~ 5-15.01 b• Gambling devices shall bE operated and raffles conducted by alicensedorganizationonlyuponpremiseswhichitawlsorleases,except that tickets for raffles conducted in accordance with thissectionmaybesoldoffthepremises. Ail leases shall be inwriting. The local unit of government may authorise raffles to beconductedbyalicensedorganizationonprenisesnotawedorleasedbytheorganization. No lease shall provide that rental Pny~nts bebasedonaperoentage•of receipts or profits from gambling devicesorraffles. c. Zbtal prizes from the operation of Paddlewheels, tipboards andpulltabs (or ticket jars) awarded in any single day in which theyareoperatedshallnotexceedonethousanddollars ($1,000.00).Total prizes resulting from any single spin of a paddlewheel, orfromanysinglesealofatipboard, each tipboard limited to asingleseal, or from a single pulltab (or ticket jar), shall notexceedonehundredfiftydollars ($150.00). Zbtal prizes awarded inanycalendaryearbyanyorganizationfromtheoperationofpaddywheels, tipboards and pulltabs (or ticket jars) and the conduct ofrafflesshallnotexceedthirtyfivethousanddollars (~i5,000.00}.Merchandise prizes shall be valued at fair market retail value. d. Ab organization Shall permit a person under the age of eighteen18) to operate or participate in the operation of a tipboard orpaddlewheelunlesssuchpersonisaccompaniedbyhis/her parent orguardia*~. An organization may prohibit all persons under the age ofeighteen (18) frcxn ~zticipating in the operation of a gamblingdeviceortheconductofaraffle. e. IJo expense shall be incurred or amamt paid in connection withtheoperationofagamblingdeviceortheconductofaraffleexceptthosereasonablyexpendedforgamblingdevicesorrafflesuppliesandequipment, prizes, rent, or utilities used during the gamblingdeviceorraffleoccasion, and license fees related to gamblingdevicesorraffles. f• Each gambling device winner or raffle wiru~er shall be determinedandeveryprizeshallbeawardedanddeliveredthedayonwhichthegamblingdeviseorraffleoccasionisconducted. S~nbdivision 9. 1' ,~~i a. All operation of gambling devices and the conduct of rafflesshallb2underthesupervisionofasinglegamblingmanagerdesignatedbytheorganization. The gambling manager shall beresponsibleforgrossreceiptsandprofitsfromgamblingdevices andrafflesandfortheiroperationincompliancewithallapplicablelawsandordinances. 35 ATTACHMENT A-7 MtR~ICIPAL NATION & ~CErZSING 5-15.OI b. The gambling manager shall give a fidelity bond in the sum oftenthousandcollars ($10,000.00) in favor of the orconditionedonthefaithfulperformanceofhis/her ies~t In lieuthereof, the organization may keep in full force and effect apositionbondorfidelityinsuranceintheamount ©f not less thantenthousanddollars (510,000.00) insuring the organization againstthedishonestyorfraudulentconductofitscablingmanager. Thetermsofthebondorinsuranceshallprovidethatnoticebegiven inwritingtotheClerkA3ainiBtratornotlessthanthirty (30) dayspriortoitscancellation. c. A person may act as both gambling aanager and bingo manager forasingleorganization, but a gambling manager for a singleo~r~ganization shall not act as either a gambling r or bingogerforanyotherorganization. dthe ~~~ used organization that changes gambl~q ~gers duringYearshallreportsuchchangeinBaitingWithinseven7) days to the Clerk/A3ninistrator. b~division 10. Becords of Qrns- G_~Dts exoen~ ,,,,,a profits a. Each organization licensed to operate gambling devices shallkeeprecordsofitsgrossreceipts, quantity of free plays, if any,expenses and prof its for each single gathering or occasion at richgamblingdevicesareoperatedoraraffleisconducted. Alldeductionsfromgrossreceiptsforeachsir~le tethering or occasionshallbedocumentedwithreceiptsorotherrecordsindicatingtheamount, a description of the purchased item or service or otherreasonforthededuction, and the recipient. The distribution ofprofitsshallbeitemizedastopa~+ee, purpose amotmt and date ofpayment. b. Gross receipts from the operation of gambling devices and theconductofrafflesshallbesegregatedfromotherrevenuesoftheorganization, including bingo gross receipts, and placed in aseparateaccowlt. Each organization shall have separate records ofitsgamblingoperations. Tt~e person ~o acootmts for grossreceipts, expenses and prof its from the operati;oci of gamblingdevicesortheconductofrafflesmaybethesamepersonwhoaccountsforbingogrossreceipts, ems and profits. c. Each organization licensed to operate gambling devices or toconductrafflesshallreportmanthiytoitsmembership, and to thecitycamcil, its gross re~oeipts, expenses and profits from gamblingdevicesorraffles, and the distribution of profits itemized asrequiredinthisSection. 36 ATTACHMENT A-8 RDG[JIATION ~ LICEISSING 5-15.02, 15.03 d. Records required by this section shall be preserved for three3) years, and organizations shall make available their recordsrelatingtooperationofgamblingdevicesandtheconcoctofrafflesforpublicinspectionatreasonabletimesand`pla~s, 5-15.02 Subdivision 4. LicensesissuedbytheCityshallbespecificastotheaddressofthelioPnsee.If a business is operated at more than one ],ovation within the City ofFalconHeights, a separate license shall be required for each address atwhichoperationsareconducted. Subdivision 1. Generally, a license is hereby required for any personoperatingaseasonalbusinessinanR-1 or-B-1 district of the City ofFalconHeights.. Subdivision 2. Insurance. No license shall be issued under thissectionuntiltheApplicantshallfilet~rith the C1erk-Administrator aQertificsteofInsuranceintheamamtof5100,000/$300.000/$b0,000. 5-15.03 rprtain S; caZG Subdivision 1. c'prta;n g;c1I1~ Signs oncabstandsigns, bus stop shelters, churcplaces, shall require a license. benches or newsstands, h directional signs, and similar 37 ATTACHMENT B-1 PROPOSED AMENDMENTS TO-CITY CODE CHAPTER 5 PART 15. REGULATION OF NON-PROFIT ORGANI7.ATION GAMBLING 15.01 Regulation of Non-profit Organization Gambling Subdivision 2. License. a. Required; eligibility. No person except an organization licensed under thisordinanceshalloperateagamblingdeviceorconductaraffle. An organizationmayoperateagamblingdeviceorconductaraffleifithasbeeninexistenceforatleastthree (3) years, has at least ~~~r~~-{38} fifteen (15) active members,has a license to operate a gambling device or conduct a raffle and complies withMinnesotaStatutes, Chapter 349, relating to gambling devices and raffles, and theprovisionsofthisordinance. F b. Term; restriction on frequency of use. All licenses issued under thisordinanceshallbeforone (1) year and shall be limited to one farm of gambling.All forms of gambling except pull-tabs shall be limited to three (3) calendardaysayear. For purposes of this ordinance, raffle apparatus shall be consideredtobeusedortheraffleoccasionconductedonthedayinwhichthedrawingtakesplaceandtipboardsandpaddlewheelsshallbeconsideredtobeused, or the tipboardand/or paddlewheel occasion conducted on any day in which numbers or chances aresold. An organization obtaining a license under this ordinance shall inform thee~kfPse~m~a~stea~ee City Clerk in writing of the dates on which the organization11conductaraffleorgamblingoccasion. Such notice shall be given at leasttwo (2) weeks prior to the date or dates specified for the conduct of the raffleorgamblingoccasion. Subdivision 3. Application for License. a. (No changes being made in this section.) b. The Council shall act upon an application within eae-ktradre~-e~g~~~-{}gg}-~e~9sixty (60) days from the date of application, but shall not issue a license untilatleastthirty (30) days after the date of application. Subdivision 5. ~S~~se-€ee;-exp~ret#arr-~e~er Local Expenditure and Local Tax. a. eke-eaasa~-~~eease-€ee-~e~-e-~#eea9e-~egtt~~e~-~~-~~~9-ee~~eaaee-she~~-~e-~r~ea~~t~e-{~~~.-8A}- (License fee will be added to Section 5-14.02.) The City Council may designate the expenditure of ten (10) percent of the net profits from anylawfulgambling. b. (No changes being made in this section.) c. In addition to an annual license fee, a tax of three (3) ercent per ear shall beimposedonthegrossreceiptsofalicensedorganizationfromaIIlawfulgamblinglessprizesactuallypaidoutbytheorganization ATTACHMENT B-2 2- Subd. 8. Conducting operation of gambling devices. No changes being made in this section.) b. (No changes being made in this section.) c . ~ata~-pr€aes-€rage-~~te-eflerat~€ea-a€-pad~~~ewkee~s; -~€p-bears-arrd~-pe~~-tabser-~€etfet-bars }-avaar~ee~-€a-aa~*-s#rrg}e-~a~-#a-6a}~#e}t-tbe~-ere-e~eee~e~-she~~-ae~e~eeee~-e~te-t~}~atrsea~-~e~~ars-f~};888.-88}- Total prizes resulting from any singlespinofapaddlewheel, or from any single seal of a tipboard, each tipboardlimitedtoasingleseal, or from a single pull-tab (or ticket 5ar), shall notexceedeae-bea~re~-€€€~~-~e}}.grs_~~}r~8r~} ~o Hundred Fifty Dollars ($250 00).eta~-pr€aes-e6asr~ed~-#a-eat-ee~erc~ar-dear-b~-ea gert~za~teri-€rem-~}~e-egere~€ert-e€ped~~e-`a~ree~s,--t~ €p{~oar~s-errs-ps}}-tams-{er-~3eket~-~arssire€~-eiet-exeee~-tai€rt~_€iroe_tkat~sarr~-~e~~ars- f ~3~~888}; ~~rchand iseeprizesashallbevaluedatfairmarketretailvalue. d. (No changes being made in this section.) e. iVa-e~gease-ska~~-~e-€aesrre~-er-s~artat-g$~-}r~-eeaaeet~ea-~ti~-the-e~erst#er~-e€-sg~b€€ng-~e*~~ee-er-t}~e-earc~set-e€-a-ra€€~e-e~ee~t-t}~ese-reasasab~~-e~pea~e~-€erga~b~#ag-el~CV€ees-ar-ra€€~e-s~tpp}#es-arm-eq~t#ggaeat; -gr#tes; -rent; -er-~}}3ties-irse~sr€ag-tbe-ga~b€}rtg-d~e~}ee-ar-re€€}e-eeees€ar~,--artd~-~€eease-€ees-re~ate~-te-ge~b€€age~€ees-ar-ra€€}es_ Any organization may not expend more than fifty five (55)percent of its rofits from bingo and fort -five (45) percent of itsotherformsoflawfulgamblingonallowableexpenses. Profit from bd. 10. Records of gross receipts, expenses and profits a. (No changes being made in this section.) b. (No changes being made in this section.) c. (No changes being made in this section.) d. (No changes beinglmade in this section.) e. The CouncilUshall re uire an annual financial audit of an or anization thatconductslawfulgamblingintheCityofFalconHeightsTheauditshallincludeinformationonallgrossreceipts, profits, and expenses incurred by theorganizationi, the conduct of lawful gambling as well as information on uses ofrofits. The ..udit shall be submitted to the Council no later than sixt (60)da s after the end of the lawful amblin license ear. U on review of the audittheCouncilreservestherihttorevokethelicenseofanoranizationconductincharitablegamblingintheCitofFalconHeights ATTACHMENT C-1 MUNICIPAL RDGIJIATION AMID LICEIZSTNG 5_13.01/14.01, 14.02 Subdivision 1. ~ In the event an individual fails toobtainthenecessarylicenseorpermit, that frx3ividual shall be guiltyofamisdemeanorandshallbepunishedbyafinenottoexceedbyimQrisonment, not to exceed 90 ~ X00 or ys, or both. Subdivision Z. In the event anindividualisdeniedalicenseorpermit, that individual may notreapplyforalicenseorpermituntilsix (6) months have passed fromthedateofthedenial, PART 14. LICEASF.S, PERMITS At~D OTf~R FEES CJ r~ U 5-14.01 Fses. The City Council shall, by resolution, establish and reviselicense, permit and other fees. 5-14.02 Sisiness •~ ro*±~ Business licenses are rfollowing• squired to operate the F~€ Item S 15.00 each 30.00 each 10.00 per chair 3 0.0 C maxiruan 25.00 1s.0o 10.00 per lane 50.00 ~~.-8A 30.00 per stall 35.00 25.00 35.00 10.00 2.5 0 35.00 so.o0 1st 3 pumps 10.00 ea. add'1. P~mP 50.00 35.00 50.00 75.00 4,000.00 200.00 Amusement Machines in Game Roo¢n Amusement Marines in Other EstablishmentsBarber/Bea:~ty Shops Billiards/Pool - 1st table Billiards/Fool -all others each Bowling P1 ley 3~age Charitable GamblingCarwash Chr isttnas Tree Sales Cigarette Sales Including Vending MachinesGeneralContractors Dog Licenses (Life of Doq) Dupli®te Dog Licienses Equipment Rental Filling Stati,cns Filling Stations Garage and Repair Shops Grocery Stores, 1st 1,000 sq. ft. Grocery Stores, 3,001 to 7,000 sq. ft. Grocery Stores, 7,001 sq. ft. and overLiquor Sunday Liquor t' Consent Policy X Meeting Date:9/28/8 CITY OF FALCON HEIGHTS Agenda Item: F-6 NEQUEST FOA COUNCIL CONSID~AATtON ITEM DESCRIPTION: Community Park Building SUBMITTED BY: Jan Wiessner REVIEWED BY: EXPLANATION/SUPIl~IARY (attach additional sheets as necessary} Attached are brief update reports on .the status of the fire investigation andactiontakentodatefollowingthefirethatoccurredonSeptember12thattheCommunityParkBuilding. a) Fire Report and Status of InvestigationFireMarshal, Terry Iversonb) Update on building security and insuranceAlRolek Recommendation for Future We had planned to hire a consultant in 1989 to stud ouraidinlongpgY park facility needs tog-ran a lannin Now, due to the fire, we recommend that we expeditethisstudytodeterminecitywideparkfacilityneeds !,prior to making a decisionon ;.whether to replace, or repair the building. Carol Rriegler is checking intoalternativeswhichmaybeusedonaninterimbasisfairawarminghouse (such asrentingtemporaryshelters). ACTION REQUESTED: We recommend that a Request for Proposals (RFPfromParkandRecreationCommission) and sent tobconsuiltants whotdof (with inpuEplanning (See attached proposed RFP parkprocess.) 6/29/87 r FALCON HEIGHTS 2077 W. LARPENTEUR AVENUE FALCON HEIGHTS, MN 55113-5594 PHONE 612-644-5050 September 22, 1988 T0: Jan Wiessner Mayor and City Council FROM: Terry Iverson Fire Marshal On September 12, 1988, the Falcon Heights Fire Department respondedtoastructurefireat2050Roselawn. The north section of the building was engulfed with a rapidly spreadingflame, which required both pumper apparatus with master water streamlinestosuppress. Initial investigation by Terry Iverson revealedobstructionsblockingFireDepartmentaccess. Multiple fire originsweredetermined. and all accidental causes were ruled out. Arson wasdeterminedtobethecause. Minnesota State Fire Marshal SpecialistRonRahmanwascalledformoreextensiveinvestigationandconcurredthecausewasarsonwithfourdistinctorigins. Investigation iscontinuingbyTerryIversonandinvestigatorGilSchroepferoftheRamseyCountySheriffsDepartment. F,~i<.,,., TDI:k~z HOME OF THE MINNESOTA STATE FAIR AND THE U OF M INSTITUTE OF' AGRICULTURE REQUEST FOR PROPOSALS - TIME. LINE October 10 Request for Proposals finalized at Park andRecreationCommissionMeetingOctober14RequestforProposalsbesenttoPark Planning Firms November 7 Proposals will be asked to be submitted Proposal Review November 7-14 Proposals reviewed by staff and Park and Recreation CommissionNovember14Decideonfirmstobe interviewed at Park and Recreation Commission MeetingNovember21-28 Interviews scheduled for Special Meeting(s)December 14 Park and Recreation Commission makes recommendationatCityCouncilMeeting REQUEST FOR PROPOSALS Staff and Park and Recreation Commission will prepare a Request for ProposalswhichwillaskinterestedfirmstosubmitproposalsforanassessmentoftheCity's Park Facility Needs and for assistance in Long Range Planning. It isrecommendedthattheRFPincludethefollowing: 1. A request for firms to briefly describe their experience and qualificationsintheareaofparkplanning. 2. A desire for a needs assessment to determine how well our current parkfacilitiesaremeetingtheneedsofthecommunitypresentlyandwhatimprovementscanbemade. The City's geographies and demographicsshouldbestudiedandconsidered. Also, of consideration should be howotherlocalparksoutsidetheCitymightbeservingFalconHeightsresidentsandfillingtheirneeds. This assessment should also determine how wellexistingfacilitiesmeettheneedsoforganizedrecreationprogramsanddeterminefuturepriorities. 3. After determining the park facility needs, assistance would be requestedindevelopingalongrangeimprovementplan. j ~ ~ C.avw.uk:-~a,~~ „w1.t.~, r~.ec.c~. olo (~ ~t.61}c;~.~~ ~ ~ ; C,~GwI~P,n.~- CK 9-23-88 FALCON HEIGHTS 2077 W. LARPENTEUR AVENUE FALCON HEIGHTS, MN 551 1 3-5594 PHONE 612-644-5050 September 22, 1988 TO: Mayor and Councilmembers FROM: AI Rolek RE: Community Park Building Fire r^ollowing the September 12 fire at the Community Park building, we calledurinsurancecompanytoreporttheincident. Greg Revering of GABusinessServicescameouttothescenetochecktheextentofthe damageandtotakethereport. Upon his suggestion, we hired Giertson Company tosecurethebuildingbyboardingupwindowsand. enclosing the buildingwherethefirehadburnedthroughwalls, etc. (at a cost of a5200). Greg Revering also had a PProximately done for the insurance company, asrwelleasnaedetaillestimateeoflthescenedamages. We should be receiving the results of this estimate by September23. It was also suggested that the City acquire a second damageestimate. We have contacted McGough Construction and they are lookingintothisforus. The park building was insured for $ 94,380, less our deductible of510,000. The contents of the building were nat covered under ourinsurancepolicy. However, it is possible that any equipment which may becoveredascc~tent.s of City Hall, and was in the park building at the timeofthefire, would be covered. We will keep you up to date as this claim progresses. HOA4E OF T!iE MINNESOTA STATE FAIR ANO THE U OF M INSTITUTE OF AGRICULTURE 1' Consent Policy X Meeting Date: 9/28/8f CITY OF FALCON HEIGHTS Agenda Item: F-7 REQUEST.FOR COUNCIL CON8lOEgATlON ITEM DESCRIPTION; Consider posting west side of Snelling Drive, Larpenteur to Hoyt."No Parking" SUBMITTED BY: Dick Airos, MN/DOT/Vince iaright Public i~7orks REVIEi~IED BY: Staff EXPLANATION/SUMMARY .(attach additional sheets as neeessa ry)~MN/DOT has recommended that Snelling Drive be posted:'"No Parking". See attachedmemo. Several years ago MN/DOT provided. the City with "No Parking".signs for useontheserviceroadsduringtheStateFair. These signs could be installedpermanentlyatnocosttotheCityotherthanlabor. ACTION REQUESTED: Approve/disapprove 7 6/29/87 FALCON HEIGHTS t./4riPENTEUR AVENUE FALCON IiEI(sHTS, MN 55113.5594 Punr.~r ,. vw-au~ September 22, lggg T0: Jan Wiessner FROM: Vince Wright I received a call from Dick Airos, Engineer from the State Highwa De He received a call from someone higher up and then he called me. Y partment. They had received a complaint from someone on Hoyt and Snelling Drive ab the people coming off Snelling Avenue from the north and turning into HoottandthenmakingaquickleftontoSnellingDrivecuttingthecornertooshort They are also coming onto Snelling Drive from the south from the shop in Y center. They are going too fast and do not always stop for the stop sign on Hoyt. Dick told me that he put biAvenuetopreventpeoplefromturningtheecorner2too sharoyt and Snellingthatwehavethepolicewatchthatareaatnoonandat5:00 p.suggestedeve 'frv~e €lk ~bma~~.~. ~.~~.~~~~'t~t, L~he ~e a '~e~+: _ tested ~tfi1,s °"~''°" rin~,.~d_.~eave~` ..t ~ ~~,eC~ti$e th$ ,(~,_..j$ ~~rt t-_rryrra, .$e r~ _ .. -mot eider ~f the ro -~; ~ ' -~-~`""~ , ~Y,~ feeC #,nt ~ . , tic . aad ~>wit~' ~ _cars"etroadbestriped '"and ma be°'`" ~-~ ~ He also suggested thatMingiretiesi Y Put up a sto ~ ad sishou"1~ . P a e ~~~3[ ~~d ~ ti1~sts .sad l~~ L could ." d..~t~tip°l~aeget ~7ick- toy`paint the stripes in the street.ick has aone some research into this problem and he thinks his requests are valid and I have to agree. For more information please talk to me. Please take these recommendationsunderconsideration. V~,': k j z ~~~~ HDME OF THE µtNNESOTA STATE FAlR'AND THE U OF M iN$TtTUTE OF AGRICULTUF~ i Co~isent Policy X CITY OF FALCON HEIGHTS r~ U REQUEST FOR COUNCIL COaSlDERATlON Meetinf~ Date: 9/28/8f Aganda Item: F-8 ITEM DESCRIPTION: Resolution authorizing the County Auditor to reduce the debt levy by $24,400. SUBMITTED BY: Al Rolek- REVIEWED BY: Al Rolek EXPLANATION/SUMMARY (attach additional sheets as nectssary): The 1983 Bond issue for Falcon Woods ~~3 improvementsicarries a provision for an automatic levy of taxes to cover any shortfall in tax increments. The levy for 1989 is $24,400. In previous years, we have passed resolutions for this same purpose and have never levied taxes for pa~/ment of this bond issue. l ~ ~-'V ACTION REQUESTID: As our debt service is adequate to fund these bonds, I recommend that Resolution R-88-17 be adopted reducing the debt levy by $24,400 in tax year 1988/89 for the G.0. Tax Increment Bond s dated 9/1/83. e / 6/29/87 i No. R-88-17 CITY OF FALCON HEIGHTS C O U N C I L R E S O L U T I O N Date September 28, 1988 A RESOLUTION RELATING TO AUTHORIZING THE COUNTY AUDITOR TO REDUCE THE DEBT LEVY BY $24,400 IN THE YEAR 1989, WHICH WAS TO BE PROVIDED FOR IN THE GENERAL OBLIGATION TAX INCREMENT 525M) of SEPTEMBER 1, 1983 Yeas Nays BALDWIN in Favor CIERNIA CHENOk'ETH Against WALLIN BUSH Adopted by Counci l September 28, 1988 RESOLVED, that the City Council of the City of Falcon Heights has onhand excess funds in its debt service fund in the amount of $24,400 which havebeenirrevocablyappropriatedtoreducethedebtlevyfortheSeptember1,1983 Tax Increment Bond issue, and hereby directs the Ramsey County Auditortoreducethedebtlevyrequirementsintheamountof $24,400 listed onhisscheduletobeprovidedforGeneralObligationTaxIncrement (525M)September 1, 1983. Moved by Approved by Mayor September 28, 1988 Date Attested by Clerk Administrator September 28, 1988 Date Consent Policy X 1 7 CITY OF FALCON HEIGHTS REQUEST FOR COUNCIL CONSIDERATION Meetins~ Date:9/28/88 Agenda Item: ~'~ ADDENDUM ITEM DESCRIPTION: Funding Request for Computer Analysis Program SUBMITTED BY: Association of Metropolitan Municipalities REVIEWED BY:~ Jan Wiessner EXPLANATION/SUMMARY (attach additional sheets as necessary): We received the attached funding request from AMM after the agenda had been puttogetherforSeptember28, 1988. The request is to contribute towards a computerized tax analysis project which would be used to analyze legislativeproposals. The absence of this information made it very difficult to react to the various proposals during the last legislative session. AMM is suggesting a $500 contribution from a city of our size. ACTION RE(~UESTED: ~~ /~_ / ~~ Approve $500 allocation from 1988 Contingency Account (4497) 6/29/87 j/ t as ociation ofme~ropoirtan muniapalities P R O M P T A C T I O N R E Q U E S T E D September 21, 1988 Dear City Administrator/Manager: The Association of Metropolitan Municipalities and the Municipal Legislative Commission have been working for sometime with the League of Minnesota Cities Coordinating Committee discussing property tax computer analysis for 1989. The LMC has committed to developing computer analysis capability for the 1990 legislative session but a transition year is necessary to be able to react and participate knowledgeably in the 1989 session. The Coordinating Committee has been negotiating with the Coalition of Greater Minnesota Cities for development of a property tax reform proposal for 1989, a key element of which, will be retention of the principles of a Homestead Credit. Additional background data on the research elements and product are enclosed. This effort will cost approximately $185,000 for computer data update and proposal development. To raise this amount, Minneapolis, St. Paul, the Coalition of Greater Minnesota Cities, the Small Cit3~ organization, and the Metre Area suburbs are being .asked to make contributions. The suburbs share of funding has been targeted for between X35,000 and $50,000, which will be raised voluntarily, not through any type of mandatory assessment by either the AMM or MLC. Thus, a request for financial contribution is being made of all suburban cities. The larger member suburban cities are being asked to commit $2,000 each to this effort. Your city, taking into consideration its smaller population and budget limitations is being asked to contribute what you feel is appropriate. This financial pledge is contingent upon two factors: 1) AMM and MLC Boards approval to proceed with this project, and 2) Sufficient funding from the suburbs to raise the required amount of dollars. It may be imperative for all cities, especially suburban cities to 183 university. avenue east, st p-~: mirnes~,ta 55101 (612) 227-4008 lJ develop a common proposal for the 1y89 legislative session. Based on the 1987 and 1988 tax and school funding hills, counties and school districts are committing to a significant effort for additional funding in 1989, probably at the expense of cities. This. is primarily possible because of the elimination of Homestead Credit in 1990 in favor of an aid type program. Since the suburbs are at the greatest risk if Homestead Credit is exchanged for aid, it is paramount that a strong effort be made to restore the Homestead Credit. The data base or information which should result from this one time effort will help assure that the professional staffs of AMM and MLC that represent the suburban cities will be on an equal footing with other city lobbyists in the state during the. 1989 session. Without the availability of this information and a unified position supported by all cities, success in protecting the suburban interest is in doubt. Please, strongly consider this request with your council and reply using the enclosed pledge sheet or verbally no later than Wednesday, October 5, 1988 to the AMM Office. If you have any questions, call Vern or Roger at 227-4008. Respectfully, Gary Bastian, President Association of Metropolitan Municipalities Wl Richard Wedell, President Municipal Legislative Commission r` T0: ASSOCIATION OF METROPOLITAN MUNICIPALITIES MUNICIPAL LEGISLATIVE COMMISSION 183 UNIVERSITY AVE., EAST ST. PAUL, MINNESOTA 55101 FROM: CITY OF YES, OUR CITY WILL PLEDGE $ IF THIS EFFORT CONTINUES. N0, OUR CITY WILL NOT CONTRIBUTE. CITY ADMINISTRATOR/MANAGER r. LEAGUE COORDINATING COMMITTEE RECOMMENDED RESEARCH PROGRAM FOR OCTOBER THROUGH JANUARY The major research tasks recommended for .the League Coordinating Committee through January 15, 1989 are briefly described below. The research tasks have been organized into three major areas of research work. I. Data Base Additions and Modifications Add data on homeowner income related to home value and tax burden, and develop analytical model for using this data in conjunction with the property tax model. Enhance ability to do regional totals and averages, constituency group totals and averages and average impact by property type. Add county welfare data. Add State Auditor's data on city revenues and expenditures for 1987. Update data base with estimated 1989 data when available from the Department of Revenue or House Research. Most recent information indicates that valuation data will become available in late October, and levy data will be available one or two months later. II. Background Research and Analysis of the 1990 Law The first major research task is the analysis of the 1990 law, including its structural features and estimated impacts on property tax burdens. This research work may include analysis of the fiscal characteristics of cities in different regions of the state, and how those characteristics play a role in determining the impact of the 1990 law. III. Research to Develop Specific_Proposals for Consideration by the legislature The primary objective of this work plan is to develop two specific proposals that are acceptable to the Constituency Groups. One of the proposals would include a homestead credit and the other would not. The research involved in developing a specific proposal is difficult to describe in detail. It is generally an interactive process where alternative proposals and their impacts are described 7 J to the Committee, the Committee reacts to those proposals and provides direction for further research to refine or redirect those alternatives. Dozens or even hundreds of individual computer runs may be needed in order to design a specific proposal that is acceptable to the participants. the elements of the system that will be considered in designing a proposal may include the following: Classifications and assessment ratios. LGA, disparity aid, and other equalization formulas. The homestead credit, other credits, and, in the case of the alternative proposal, transition aid payments or other programs that replace the homestead credit. Categorical aids, such as the welfare takeover that are either in addition to or in lieu of other state-paid aids. Fiscal disparities or tax base sharing programs. Income adjusted property tax refunds or an income adjusted homestead credit. Extensive computer analysis is needed to assess the inter-related impact of changes to all elements of the system. It will be necessary for the Constituency Groups to focus the research effort very early in the process. without some initial policy agreements, the research effort could become unfocused and would more likely be unproductive. The research work for the first several meetings would be designed to help the members of the Committee reach a preliminary agreement on the direction that the proposals should take. The research needed to develop specific proposals may include some of the more specific research tasks already suggestedbyCommitteemembers, assuming that the Committee agrees that these specific research tasks are needed. Some of the specific items suggested so far include: Analysis of impact and appropriateness of using city size as a basis for distributing aids. Elimination of split classifications; impact on tax burdens and on the distribution of aid. Research on the design of new property tax systems that do not require or encourage mill rate buy-downs or mill rate equalization. Research on single aid programs that could replace the multiple programs in current law. Research on modifications to 1990 law to refine aid programs and classification system. Analysis of property tax burdens by income class. Research on impact of property tax. system changes on the existing education aid formula and on school district levies. Analysis of projected school levy changes for 1990. Analysis of ways to reduce tax burden. differences due to differences in tax base. These items illustrate the types of specific research that would be undertaken for the Committee. This research is consistent with the general structure of the recommended research program. The Committee would have to decide as the negotiations and meetings progress on the specific research to be done. Membership of the League Coordinating Committee would in include three members from each of the following groups: Minneapolis St. Paul Coalition of Greater Minnesota Cities -- Association of Metropolitan Municipalities Municipal Legislative Commission Association of Small Cities CITY OF FALCON HEIGHTS (NF AGENDA r - ~ SEPTEMBER 28, 1988 ~ '~~~ A. `CALL TO ORDER 7:00 P.M. B. ROLL CALL: BUSH __/ CIERNIA ~_ P. CHE OWETH ~ WA LIN _~ / BALDWIN / WIESSNER / S.CHENOWETH ~ ATTORNEY ~ ENGINEER Y C. APPROVAL OF MINUTES OF SEPTEMBER 14, 1988: ACTION: D. PUBLIC HEARINGS: 1. 7:15 P.M. - 1989 Budget Hearing ACTION: E. CONSENT AGENDA: 1. Fire/Rescue Runs 2. Disbursements a. General Disbursements through 9/28/88, $96,895.36 b. Payroll 9/1/88 - 9/15/88, $10,009.17 c. Statement from Maier, Stewart & Associates for Services through 8/27/88, $2,045.74 d. Statement from Dahlgren, Shardlow & Uban through 8/31/88,833.33 3. Cancellation of Check #22117 issued to Ceres Tree Service in the Amount of $3,768.55 4. Commission Minutes a. Solid Waste Commission Minutes of September 7, 1988 b. Planning Commission Minutes of September 12, 1988 c. Human Rights Commission Minutes of September 15, 1988 5. Licenses 6. Designation of Bill Walsh as City Plumbing Inspector ACTION: F. REPORTS, REQUESTS AND RECOMMENDATIONS: 1. Coffman Street Parking ACTION: 2. Larpenteur/Prior/Gortner ACTION: 3. Request for Removal of Temporary "No Parking" Signs from St. Mary's St. ACTION: 4. Northwest Area Storm Drainage Study Update A CT I 0 N : __._.~ __ _ ~_ --~~_._..~_.._.-- S. Charitable Gambling ACTION: AGENDA SEPTr:MBER 28, 1988 PAGE 2 6. Community Park Building ACTION: 7. Consider Posting West Side of Snelling Drive, Larpenteur to Hoyt,No Parking" ACTION: 8. Proposed Resolution Authorizing the County Auditor to Reduce theDebtLevyby $24,000 ACT ION : G. ANNOUNCEMENTS AND UPDATES: ~. w H. ADJOURNMENT: ACTION: w_..._._.r._,_._. MINUTES REGULAR CITY COUNCIL MEETING SEPTEMBER 14, 1988 Baldwin convened the meeting at 7:00 P.M. PRESENT Baldwin, Wallin and Ciernia. Also present were LJiessner and Rolek. ABSENT P. Chenoweth and Bush MINUTES OF AUGUST 24, 1988 APPROVED Council approved the Minutes of August 24, 1988 as presented. CONSENT AGENDA APPROVED Council approved the following Consent Agenda as presented: 1. Disbursements a. General Disbursements through 9/14/88, $22,382.75 b. Payroll 8/16/88, $8,543.53 2. Appointment of Brian Stenquist, 1775 Tatum Street, to Human Rights Commission (term to expire December 31, 1989) 3. Proposed Resolution R-88-15, Joint Powers Agreement Suburban Home Share Program 4. Licenses CHARITABLE GAMBLING IN FALCON HEIGHTS Jay McNabb made a presentation on charitable gambling. The Fire Department Relief Association in the future will be requesting permission to offer charitable gambling (pull tabs), which will require a City Code change.McNabb reviewed what Code changes would be needed. and what fire equipment needed replacement. He then reviewed what processes would be followed, where the pull tabs would be sold, who would sell them and how it would be monitored and controlled. Councilmembers Ciernia and Wallin expressed approval of the concept while Mayor Baldwin stated that he had some ethical and philosophical difficulties with the idea of a taxing authority operating charitable gambling. Mayor Baldwin directed administrative staff to research the charitable gambling issue and prepare a detailed report to be discussed at the September 28th Council meeting. REGULAR CITY COUNCIL MEETING MINUTES SEPTEMBER 14, 1988 PAGE 2 A NEW STRUCTURE FOR COMMUNITY CABLE ACCESS Cable Commissioner Ron eggert referred to the Executive Summary of a New Structure for Community Access in the North Suburbs Report and recommended approving the proposed resolution to proceed with negotiations directed toward achieving the goals as stated in the report. He also reviewed the access effort as required by the franchise and required sources of funding. After a further discussion, Ciernia moved adoption of Resolution R-88-16. Motion carried unanimously. RESOLUTION R-88-16 RESOLUTION SUPPORTING COMMUNITY ACCESS MANAGEMENT BY A NON-PROFIT CORPORATION ADJOURNMENT Council adjourned the meeting at 7:58 P.M. C J Tom Baldwin, Mayor ATTEST: Janet R. Wiesner, Administrator onsent 1,Scnda Item: D-1 sy CITI OP TALCON HEIGHTS Il~tetinS Datc:9/28/88 iEQUPST TOa COUNCIL CONSIDERATION Consent x tolicy 1~end~ Ittt: E-1 CITY OP lALCCN BEIGBTS setis-= Dsts: g/28/88 QUEST TOlt t~0'IINCIL COIISIDLRAT]IOIi IT1M nESCltitTION: Fire Department Reports SDDJ+IITTED ET: ItEVIEfiED DY: Shirley Chenoweth Leo Lindig I~PI~AAUTIOA/StiIQiARy (attacD additio~aal sDeets as ncces~); FALCON HEIGHTS FIRE DEPARTMENT CALLS June July Fire Calls 1 5 Rescue Calls 15 g False Alarms 8 1 TOTAL 24 15 LAUDERDALE Fire Calls Rescue Calls False Alarms TOTAL June July 6 9 6 2 3 3 15 14 Au ust 3 8 4 15 August 3 7 4 14 ACTION REQtIESTID: Consent_~ Palicy_„ CITY OF FALCON $EIGSTS tEQVEST !OR COONCIL COIiSIDl~RATIOli ITElI DESCaIpTION: Disbursements genda Item: E-2 Meeting Date: 9_88 SUBMITTED SY: Al Rolek EVIEI~iED BYs Shirley Chenoweth E7~LAIaATIOp/SUl4~IARY (attach additiat:al sheets as aecessazp) a) Disbursements through 9/28/88 - $96,895.36 b) Payroll 9/1/88 - 9/15/88 - $10,009.17 c) Statement from Maier, Stewart and Associates for services through 8/27/88 - $2,045.74 d) Statement from Dahlgren, Shardlow & Uban through 8/31/88 - $833.33 ACTION REQ_ UESTED: u'1 O~GO~DM~D~O~O ~/'1u'1o000o0u"1 v1OOOOO ~~O~7NOM~70~ ~uIOOMT--1~7<"~'1~~•--i~C OHO 00 o~N~~0~7~~o~rnh~ u'1a~ rnOOOOO M ht11rn000~~Q~~D~D~U'100~~D111OIrlIrl000~N~700~~7.-1~ H~~MaO.N01tt1OOh O00 h .-~ t1'1 l.f'1 I!'1 11'1 I!'1 11l Irl v'1 N M ~' t!1 Ifl ~7 ~D O~ h tf1 00 r~ 111 O ri ~7 N ~1 00 Ul M N ~7 h CO N 11'1 O N M r-i N h M ~O GO N ~D 00 ~t N •--~ M w O W W H N 0 U o v a~i aGi ~ = x ~ h v o 0 w •.a H +~ N U w ~ ~ = - - - = = = = = = = A U W x 1 0 3 ai Q a ro N W U v 1 A r'~ 3 w ro0ovG ro o v as ia ro as v w ooo3f x c •~v x O O e--I I 3.t rl s+Q+ rlto g u d a~u a.+ v zs G D b i.1 G CJ cD w O v~ ~+ ro A ro q a d r+A G ao cn t~v 9,G U v zs w m v rl I v G m u .u w v r+ its v w ro ro v e •~ ~ m i G•r+v ro roro G •~Ua x ooaG rov i x v +~a oo v r+o~b~ a G u v ro v ~--~ o a p w O G. b w cn N a ~-~I GL d G G G G W C7 W U ~ a v G G G s~+u a v a v cn ro ro UJ U G ro U 0 1 In cG v G G G O A *~v v w w ors G to G U O G ro cJ~G~U G W O G G +~O O ro u v v u:.G o0 o G W G- o i o o ro h ~+ ro c!]r-1 0o G w N G Ol N v v ro .G r! to A .G O O G v ro ro o •*a r+1r +-+ u u a a ~+s~ a~ +~ w w G +~a +-~m +~v G •'-~G •~o *-I u G 00 N v v ro G •r+ +-1 •~ vv a~ w w vro o v v~mroaa i oa o o a ai ai r a iaia v~c7 U da a.~z~a~o ao Hxwd aH F+3 x~h~~ H a' A PCi H A W W C9 C A C 4 a C N v 1J N ro O OU U r~l G Otq rl ri O 1J G U 1 Gt m U m O S~+v d G w S JJ ro ro O U ro UJ f O •ri O ro U ,3 V ro i•+ w a v a ro a U 3 r+r+ v v o0 v r+ 3 G G ~+G a v~m~a o 0 o u ~+ F+ ~+ C1 ro G oo ro G ~+ o C w H a, .n ,~ m W n G l+ Sa O b A ~+ ~ S~ p41CJm r•I d m ~+U o ..~m G a~ G 01 O ro U O ~+ro Y+ ro ncn .-~ ,~ u G ~+v ro m y G O ro~ rob G v ro v o u .C U ro v u ~+v u 0o v •~ ro v c~ a o~ro G 0 U u G ro u u G~v ~n 1 0 1 oa on v o ro a ~ G. •r+ o ~v v aG c~ z o ~+ u 3 1 cn ~ v o ~1-+m a o x r v •~+ u t9 ro .~ro o ro ro as •~ as m y ,~v w w o ro d m w w ro v v v~as ~ cn G o ~, ro ~+1 0~~ v w w U +-1 m G v v~ro .-~a x H~~ a a a x x D, ro ve d a ro o~m P 3 o a, o i 1 o T O w v N 3 3 o V ro c7 a~ G v U 8GroGroGrlOO cn r-I v v ro O ro ro r-I r-I U w U v O a-1 N ~+ :7 v a;G oo P+O •rl d O O N O G Y+ rl b O b rl la G .~ O O O O 7, U PL U] .-i ~+ H N i.1 00 d-+A G ei e-i H H V1 r-1 a.1 3-i 3.+ ro O i-+cro ~ ro G G ~ ~+ ~+ro rJ z ~OC ~G G H m ~p m .c ~zs ~i w ro p IFA3Cl d HHU 0.'m tYIA d dA~Ua U~nUUhf~C~AC7£a AQ+UU A dU£a N M ~7 t11 ~O h 00 O~ O " ~ N M ~7 t1'1 ~C h OO OI O •"~ N M ~Y t11 ~D h 00 a1 O .-i N M ~ t/1 ~O h 00 01 O •"'i N M OOO0OOOOr-I •-+•--~~^'^'1 "'~ ^+^''""'4NNNNN N NNN NM Mc'lMMM MMMM~td~Y~t N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N fV N N N N N N N N N N N N N N N N N N N N N N N N N N N v1~7O0NO~o u1OO0N~d t~oO~tO~0OOOOOOOOOOOOO~0O~OO~p No0OO0f1OO~O~'~7t~nn M.-i O~'1N000OOOOOOOOOOM0O~~1M f1 O O C70 M u'1 O N C70 C70 ~O O .--I u'1 N O~ u'1 (T M O N N ~t I~ CT ~t N ~t O N ~O C70 .-I ~ ~ ~ u'1 rl N ~ ~ tr1 t/'1 u'1 ~O N M N ~7 ~7 f~ M M O ~7 N M .~ N •--i N ~--~ N M .--~ O C70 .N~ ^ u'1 ap 7 ~Y' N M u"1 00 '-I O rl C70 ~ 0 N N M ~ W w H z H C7 a~ z rx A as A W Z W C7 O y a O H A w H O 2 1E L W S L m v I u 3H 0 r-I on m ~ ca N w hUG +~p G G I IaI u=o ia.a fn •,~ >•+ ~u to ,-I ~ fA I -~H r+ ~+ a a v d ~ +~ v a rl o ro t~ a o o z~o a sa v ro a fr a a. +~a = a w w w M •~ ~+ w w a v v G a c oo a x x v fn ~+ ~ w u a a. C w cn b v v o bD o0 ro a. I w o v its •,~ ._c= •~I O .o •~ G ro ff N a m ~v m A a ~ ~+ •~as m G tw ~ x +-~ a s~ v n O ~ v +-~ .C al H v ro fn ++ O fn H +~ rx G v •rl ~ i-+ G~v taf) U~ v a G •~G G I U a a +~ •r•I O ro O oD D, ,~ .-i ~ oA •rl >•+oD A •,~ G ca w = ro ro v ro ~3~~x~~v ~ c7a~ ro x •.~ •~ a a ro ro ao~c~w¢~~ w ro o. ==== v~A~z r-I ca v u: ro C v m H b0 I ro ~ to U ~ b~0 ~+ .C u fwd 3 v ca U V1 ¢ a v a•+ ~ O U >•+ v L H •? •L~ O a v a u a Nfnao¢ a H O H a s~ cn o 0 ro r~ m ro ~ w rl •rl 0 0 U UW ro i 0 03vii3q b ro b H fa i.-3-i X23 v-I O C3 fU G GxNOxUOAOO S-i O U cA G N U U b o w b d a v s~ ¢v v o r-I ro o o u w o ro u u ~+z ro v G w m ro 3~ro w ro a.c o ro ro ro v 3 sr v o u m G o ro '-I o 3 3 ov a,G u s.+ovv v.~I G ro~sr ca~ 0o a a, o l o ro~ro a fn m v v v s+q u fa •~I f: •~I G a H H U UG W 3 H oCo C C •~m U tlOi W N ~G N rou o ca a. ro a ~+ u ro v v P v ro C1 w v v .n a u v 3 o G ro v rl ro v ro .n I •r-I b p U m a= a.+rn ~cn ao cn cn C G cn u a cn.I 'v ti al ¢o a G cn 3 x G ~ O ro r O O N v ro H ?a O cd H cn a rl 41 oq ro O a 0 0 o .n a v fn x a •~G v oo I .c ~+ro ro ~+ v w ty G w a a a 3 >•+v ca v v a G a. ~+ v fn v as G o •~v n s`+ ~0 0 0 a a m a G b q0 0 00 v 6 a .~v¢G •~+G o E G G fafl v ro u +~ 3 v ~rl G ro a +~I•+ o .~rl ro .n a ro G G E v ~+ro ro w •.~ sa i +~ ti u rl a ro H o •~+o 0 o x v~ •~+a o m v ro o ro o •~+ri o ro v cd •rl ..C v v C7cn cGC7 E-+~wA~O HC~>UV~U UE-~A H w"~~A h W~C7 fs+3~ t!1 ~p I~ 00 O~ O •--~ N M ~t tf1 ~L` n o0 CT O ~ N M .7 cf1 ~O n Cb fT O •"'~ N M ~7 u'1 ti0 i~ Cb (T ui ~n ~n ~n ~n ~n cn vt v~ ~n .c .c .s? .fl ~ .o ~ .o w ~ r~ ~ ~ n n ~ r\ r` r` n N N N N N N N N N N N <V N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N fV N N N N N N N N N N N N eFt N N N N N N N N N N N N N N N N N N N N N N CV N N N N N N N N N N N N N N N N N N N N N N N N r~ 1 li 14 Sep 1988 Mi10 uegisssf City of Falcon Heigfits tikb 4:10 PM y Pay Cheek Check ~10~ ~10~Par Perio 0."nP d Nurber eszriotiar Check Re~ona-t Datt Status M..~" Naee 0.00 15-Sep-88 wID 016798 0 0.00 15-Sep~B wID 016799 0 Q 00 1S-Sep-~88 VOID 016800 a o0 15-5`ep~~8 wID oibHO1 oi6eo2 aoo 1s-sep-ee wID o16eo3 aoo 1s-sep-ae wID 016601 0 aoo 1s-sep-ee wID 016806 000oooooe Hiessnr, Janet R.'17 Ol eeeilonN~ly 1,12306 15Sep~8 Detstanding 016806 000000004 Kriagler, Carol J.17 O1 pe~i-storthly 302.31 1~-9ep-88 Outstanding 016807 000000011 pennoneeth, Shirlq N.it O1 swi-eonthly 67369 iS-3ep-AS Outstandin8 Oib808 000000020 Iverson, Terry 0.1T O1 swi-Monthly 984.57 13-gep-88 OutstandinH 016809 000000027 Mon~gan, Jay N.17 01 seeiyorthly 629.07 15-Sep-88 Outstanding 016810 000000031 Rolek, Alan J.17 O1 seaiionthly 691.17 iS-9ep-88 Dutsta+dir~ 016811 0000000.;5 Zieeerraan, Katherine 17 Oi s~i-sarthly 272.60 15-hp-88 Outstanding 016812 000000038 night, Vincwit 0.1T Ol sed-raonthly 824.20 15-9ep~~8 Outstanding 016813 000000041 Ilsrtey Kristin L.17 O1 swi-sonthly 00.03 1S-Sep-e8 Outstanding 016814 000000043 Noe^n", Sue R.iT 01 aeediarthly 71.14 1S-Sep-~8 OutstaMinO 016815 000000060 Kebes, Jon E.17 O1 senaiyonthly 154.46 1 Outstniding 016816 000000061 Kelly, Jaees E.17 O1 sesiyonthly 82.78 1S-51ep-88 Outstanding 016817 000000062 Thoepeon, Mike F.17 O1 searsonthly 299.60 IS-Sp-88 Outstanding 016818 000000003 Beacom, Nidalas &9 02 eonthly 1 441.80 1S-Sep-88 Outstanding 016819 000000005 Berndt, Ross 9 02 sKxithly 1 188.00 15-Sep-88 Outstanding 016820 000000006 Bianchi, David P.9 02 eonthly 1 128.50 iS-Sep-88 Outstanding 016821 000000007 Biancfii, 3oseph D.9 02 eortthly 1 112.50 15-Sep-88 Outstanding 016822 000000008 Brornn, Rayraad F•9 02 eonthly 1 157.00 15-Sep-88 Outstanding 016823 000000013 Clarkin, Michael D.9 eonthly 1 124.50 15-5eP-88 Outstanding 016824 000000014 Dow, Michael J.9 02 eorrthly 1 134.50 is-Sep-88 Outstanding 016825 000000015 Dordell, Ralph L 9 02 eonthly 1 42.00 IS-Sep-88 Outstanding 016826 000000016 Fuller, Jaees D.9 42 eonthly 1 147.50 15-Sep-88 Outstanding 016827 000000018 Holegren, John M.9 0~2 eorthly 1 137.00 13-~Sep~~88 Outstanding 016828 000000021 KurfnaJetz, Cleaent N,9 02 eonthly 1 176.50 15-Sep-88 Outstanding 016829 000000022 l.eMey, Dennis S.9 02 eonthly 1 130. SO 1~d8 Outstanding 016830 000000023 1.dley, Derglas 9 02 eonthly 1 91.42 1S-Sep-88 Outstanding 016831 0000000~'-4 Lindig, l~0 9 O!eorthly 1 1ae.n 1S-~Sep~~88 Outstanding 016832 000000023 McDer~ond, Cindy K.+9 Oe eonthly 1 35.00 1S-Sep-88 Ekrtstandirg 016833 000000026 MdVbb, Herald 9 02 earthly 1 86.00 15-5'ep-88 Outstanding 0!6834 0000000'9 Olson, Joseph E.9 Oe eonrihly 1 82.50 13-Sep-88 Outstanding 016835 000000032 Schaefer, Rid~ard N.9 OQ eonthly 1 109.00 15-5ep-88 Outstanding 016836 000000033 Scfiarnffert, Craig h.~9 0~2 eonthly 1 107.50 1S-9ep-88 Outstanding 016831 000000034 9eida, Bail 9 Oe oornthly 1 211.50 iS-Sep-88 Outstanding 016438 0000000.39 Morgan, Jay -9 02 eonthly 1 111.30 15-~Jep-88 Outstanding 016839 000000040 Kayser, Douglas 9 OQ earthly 1 22350 1S-3ep-88 Dutstitding 016840 000000012 Stolz, Steven P.`9 Oe earthly 1 50.50 15-8ep-88 Outstanding 016841 000000044 Blanchard, Patricia M.9 Oe e~onthly 1 50.50 15-Sep~~88 Outstanding 016812 000000045 Silbert, Jer~oes J.9 02 eo~hly 1 68.50 15-Sep-88 Outstanding 016843 000000046 Holegrwy Jahn K 9 02 e~onnthly 1 206.00 iS-Sep-88 Outstanding 016644 000000047 Mriiebb, Kevin 9 02 earthly 1 lO6.S0 1S-~Sep-88 Outstanding 016845 000000049 Anderson, Kevin L 9 02 eonihly 1 232.50 1S-9ep-88 Outstanding Srand Total 10,009.17 1 i1i~/i~ilfi LbNSULTING ENGINEERS Maier Stewart & Associates Inc. City of Falcon Heights 2077 Larpenteur Avenue West Falcon Heights, Minnesota 55113 Summary of Engineering Services Rendered July 24 through August~27, 1988 Project #Project Description Invoice Amount Due 330-000-00 Falcon Heights General Service 902 285.73 330-004-70 Larpenteur Avenue Issues 903 113.80 330-007-70 Ciatti's Parking Issues 904 549.01 330-009-70 Street Maintenance Program 905 871.80 330-010-80 N.W. Area Drainage Study 906 S 225.40 TOTAL ENGINEERING SERVICES RENDERED THIS PERIOD 2,045.74 I hereby certify this represents a true and complete picture of the charges for Engineering Services during the period in question, and as such, constitutes a claim against the City of Falcon Heights. rry J. M~tr~`er, Vice President 1959 SLOAN PLACE. ST. PAUL.~MtNNESOTA 55117 612-774-6021 0 Maier Stewart & Associates 1959 Sloan Place St. Paul, Minnesota 55117 Project: 330-000-00 FALCON HEIGHTS GENERAL SERVICE Invoice No. 902 September 9, 1988 Page number 1 City of Falcon Heights 2077 Larpenteur Avenue West Falcon Heights MN 55113 For Engineering Services Rendered From July 24 through August 27, 1988 Professional Services Date Project Engineer Terry J. Maurer Other Billable 8-06-88 Clerical Marie O. Soliz Clerical 8-06-88 Staff Labor Expense: Direct Expenses COMPANY TRUCK Cost DPE Profit Hours Rate Mult Rate Molt 5.00 22.00 1.00 22.00 2.45 50 10.80 1.00 5.50 10.80 2.45 Date Amount 269.50 13.23 282.73 Amount 282.73 8-06-88 3.00 COMPANY TRUCK total 3.00 Direct Expenses Total: 3.00 3.00 TOTAL THIS INVOICE 285.73 Hamline Alley $ 67.13 Meeting with Joe Youn $ 56.90 Ramsey County TAC $ 151.70 MaiBr Stewart & Associates 1959 Sloan Place St. Paul, Minnesota 55117 Project: 330-004-70 LARPENTUER AVENUE ISSUES City of Falcon Heights 2077 Larpenteur Avenue west Falcon Heights MN 55113 Invoice No. 903 September 9, 1988 Page nwnber 1 For Engineering Services Rendered From July 24 through August 27, 1988. Professional Services Date Project Engineer Terry J. Maurer other Billable 8-13-88 Staff Labor Expense: Direct Expenses COMPANY TRUCK Cost DPE Profit Hours Rate Mult Rate Mult Amount 2.00 22.00 1.00 22.00 2.45 107.80 2.00 107.80 107.80 Date Amount 8-13-88 6.00 COMPANY TRUCK total 6.00 Direct Expenses Total: 6.00 6.00 TOTAL THIS INVOICE 113.80 Maier Stewart & Associates 1959 Sloan Place St. Paul, Minnesota 55117 Project: 330-007-70 CIATTI'S PARKING ISSUES Invoice No. 904 September 9, 1988 Page number .1 City of Falcon Heights 2077 Larpenteur Avenue West Falcon Heights MN 55113 For Engineering Services Rendered From July 24 through August'27, 1988 Professional Services Cost DPE Profit Date Hours Rate Mult Rate Mult Amount Project Engineer Terry J. Maurer Construction Administration 8-13-88 3.50 22.00 1.00 22.00 2.45 188.65 rilEifngneeonaessPro Mark J. Graham Construction Administration 8-13-88 2.50 15.50 1.00 15.50 2.45 94.94 Technician I David R. Thompson Inspection 8-13-88 1.00 11.70 1.00 11.70 2.45 28.67 Staff Labor Expense: 7.00 312.26 Direct Expenses Date Amount PERSONAL VEHICLE 8-13-88 3.75 PERSONAL VEHICLE total 3.75 COMPANY TRUCK 8-13-88 6.00 COMPANY TRUCK total 6.00 BRAUN ENGINEERING 8-27-88 227.00 BRAUN ENGINEERING total 227.00 312.26 Project: 330-007-70 CIATTI'S PARKING ISSUES Invoice No. 904 September 9, 1988 Page number 2 ect Expenses Date Amount Direct Expenses Total: 236.75 236.75 TOTAL THIS INVOICE 549.01 i• Maier Stewart & Associates 1959 Sloan Place St. Paul, Minnesota 55117 Project: 330-009-70 STREET MAINTENANCE PROGRAM City of Falcon Heights 2077 Larpenteur Avenue West Falcon Heights MN 55113 Invoice No. 905 September 9, 1988 Page number 1 For Engineering Services Rendered From July 24 through August 27, 1988 Professional-Services Cost DPE Date Hours Rate Mult Project Engineer Terry J. Maurer Report Preparation 8-13-88 5.00 22.00 1.00 construction Administ ration 008-20-88 1.00 22.00 1. Project Meeting 8-27-88 1.50 22.00 1.00 Other Billable 8-06-88 4.00 22.00 1.00 Profit Rate Mult 22.00 2.45 22.00 2.45 22.00 2.45 22.00 2.45 Technician I Suzanne Iantosca Drafting 8_20-88 3.00 9.25 1.00 9.25 2.45 Clerical Marie O. Soliz Clerical 8-06-88 8-13-88 s-2o-as Staff Labor Expense: Direct Expenses 1.50 10.80 1.00 50 _10.80 1.00 50 10.80 1.00 22.00 10.80 2.45 10.80 2.45 10.80 2.45 Date Amount 269.50 53.90 80.85 215.60 113.31 67.99 39.69 13.23 13.23 867.30 Amount 867.30 OMPANY TRUCK 8-27-88 4.50 COMPANY TRUCK total. 4.50 Project: 330-009-70 STREET MAINTENANCE PROGRAM Invoice No. 905 September 9, 1988 Page number 2 ect Expenses Date Amount Direct Expenses Total: 4.50 4.50 TOTAL THIS INVOICE 871.80 Maier Stewart & Associates 1959 Sloan Place St. Paul, Minnesota 55117 Project: 330-010-80 N.W. AREA DRAINAGE STUDY City of Falcon Heights 2077 Larpenteur Avenue West Falcon Heights MN 55113 Invoice No. 906 September 9, 1988 Page number 1 For Engineering Services Rendered From July 24 through August 27, 1988 Professional Services Date Project Engineer Terry J. Maurer Report Preparation 8-06-88 ofessional Engineer Brian D. Miller Report Preparation 8-06-88 Staff Labor Expense: Cost DPE Profit Hours Rate Mult Rate Mult 1.00 22.00 1.00 22.00 2.45 Amount 53.90 4.00 17.50 1.00 17.50 2.45 171.50 5.00 225.40 225.40 TOTAL THIS INVOICE 225.40 fl~C~, l~l .+..I`i~~ii~1~ I< y1Pi Fi~.S~ .,.~L'.. .. ._..,If S'vi7E :lip MItitiE.APCiLiS. !~1\ ~.~ Iu! f.L'3;t: ~,:,,~1 09/13/88 City of Falcon Heights 2077 Larpenteur Avenue, W. Falcon Heights, MN 55113 ATTENTION: Mayor and Council RE: Technical Assistance (#0150100) Statement of Account DAHLGREN SHARDLOW & UBAN, INC. For professional services during the period of August 1, 1988, through August 31, 1988. PLANNING CONSULTATION Preparing/Meeting Planning Commission Special Hearing Research Review File, Ordinance, Comp. Plan Analysis Neon Alley Location, Summarize Notes Total Time 315.00 Expenses Mileage Total Expenses 4.20 SPECIAL TECHNICAL ASSISTANCE Preparing/Meeting Planning Commission J. Weisner 8/19 J. Weisner, Mr. Black, A. Carrol 8/29 i..Supervision Planning Assistance Guidelines Work Product Review Writing TA Report Secretarial Service Total Time Expenses Mileage Postage/Shipping Total Expenses TOTAL TIME $1,254.00 TOTAL EXPENSES $35.09 TOTAL THIS BILL VARIANCE TOTAL PAYABLE AS PER FIXED FEE CONTRACT 939.00 30.89 1,289.09 455.76- 833.33 OF~`ICER i• Coascnt x Policy i~ i CITY OF lALCON HEIGHTS ZF.QtJEST lOR COt1NCIL COIISID~11TI0lQ Benda Item: E-3 Maating Date: 9/28/88 ITFJ4 DESCAIF?I01~: Cancellation of check ~~22117 issued to Ceres Tree Service in the amount of 3,768.55 SOE1~iITTED EY: Al Rolek REVIEWED DY: Shirley Chenoweth ERPLANATIOA/SUlQ4ARY {attach additional sheets as ne~cssary): Due to a change in the amount due, it is necessarylto cancel this check andissueanother. ACT10N REQUESTED: i Approval j I i ~ a Constnt X tolicy__CITY OF lALCON HEIGHTS REQUEST TOR COUNCIL lgsnda Item: 14stia` Date: 9/28/88 IT'QI DESCRIPTION: Commission Minutes. ~ j 8U~IITTED aT: various. Commissions REVIEWED DIY: Shirley Cheno~eth. ExPL1WATION/SUifilARY (attach additioaal sheets as nece~esary): I a) Solid ~daste Commission Minutes of September 7, 1988 b:) Planning Commission Minutes. of September 12, 198 c) Human Rights Commission Minutes of September 15~ I988 i i i I i i I ACTION REQtTESTED: ~ i Approval I MINUTES SOLID WASTE COMMISSION SEPTEMBER 7, 1988 Brynildson, Haglund, L. Klisch, Misra, Salewski and Wray. Misra called the meeting to order at 7:30 P.M. The minutes of the previous meeting were approved as distributed. Pilot Project: Misra reported that the subcomt;ttee had met but decided to wait until after this meeting to incorporate recommendations of other subcommittees in its final report. Recycling for multi-unit dwellings: Salewski and Thompson distributed an outline of their report and discussed the outline with the commission. They recommend that the cormmission institute a pilot program involving two or more multi-unit dwellings. Issues such as involvement in training of the building managers, gaining cooperation of apartment dwellers and most desirable choice of receptacles, etc. Thompson. reported that Marvin Flodin has agreed to utilize some of his apartment buildings for the Pilot Project. Salewski will attempt to contact James Boyd regarding participation of his apartment units in the Pilot Project. Pilot Project costs could vary depending upon whether a dumpster for paper and cardboard could be used at the site. Yard Waste and Composting: A subcommittee distributed and discussed an outline of their work to date. Discussions with Ramsey County Environmental Health indicates that should the city desire to pick up yard waste and use Ramsey County sites, the only composting site available would be the Arden Hi11s site. The county is attempting to purchase and develop a thirty acre mega-site " for composting which-would presumably be available for use of the city next fall. In addition to the items on the outline, the subcommittee also discussed the possibility of using biodegradable bags which would be bought and. distributed by the city or provided by the haulers. The subcommittee was directed to move ahead aad contact haulers to "cost out" the possiblilities of a one time pickup of yard wastes to be delivered to the Ramsey County/Arden Hills composting site. It was mentioned that a "composting journal" is being published which may have information about the availability of composting kits, as suggested by the subcommittee. Conversion to city funding: The matter of city/county funding is an issue to be decided largely by the count~•, ~t was decided to postpone this discussion to a later meeting of the commission. WASTE COMMISSION 2 7, 1988 Public Awareness: Misra distributed and discussed an outline of this subcommittees plan. Under the heading of,newsletter she explained that a quarterly newsletter concerning solid waste and recycling in Falcon Heights, could contain some or all of the following items: Legislative mandates and deadlines, reprint articles from journals, newspapers, etc. Information of proper disposal methods. A "waste exchange" column - eg. - individual householders exchanging household paint. 1l~e timeline snvisioned by the subcommittee entailed. preparing and dis- tributing one newsletter by the first week in Aovember. Discussion of this outline by the commission focused on giving the block worker program high priority. Organized Collection: Wray distributed and discussed the outline of the subcommittees work. Solid Waste study report to the City Council in January 1989 showed the Councils concerns with the concept of organized collection. The remaining subcommittee reports will be presented and discussed at the next meeting of the commission. The chair reported she had received a letter reQuesting the commission not to contact contract consultants directly without clearing the matter with the City Administration. The next meeting of the Commission will be September 21, 1988 at 7:30 P.M. Salewski reported that the Association of Metropolitan Municipalities and The League of Minnesota Cities has established a Solid Waste task force to make legislative recommendations for the 1989 session. Falcon Heights has been invited to send their representative to these task force meetings. Minutes of the first meeting will be sent to Salewski who will forward them to Misra. ltie meeting vas adjourned at 9:40 P.M. Respectfully submitted Benno W. Salewski, Secretary. BWS/kn MINUTES REGULAR PLANNING COMMISSION MEETING SEPTEMBER 12, 1988 Chairman Black called_the meeting to order at 7:30 F.M. Black, Barry, Duncan, Nestingen, Carroll and Daykin. Council Liaison Wallin was also present. Finegan, Grittner and Boche. Barry moved, seconded by Daykin, approval of the August 1, 1988, and August 22, 1988, Planning Commission Minutes as presented. Ration carried unanimously. Chairman Black briefly rtt~.wEd the request by William A. Madden, Chair Ad Hoc Parking Committee for 1666 Coffman concerning the proposed parking restriction on the east side of Coffman Street as well as background information. Mr. Madden informed that he contacted both the state of Minnesota and Ramsey County concerning the legality of parking permits and he was told that Falcon Heights has jurisdiction over their own streets and can issue whatever permits they wish. He then reviewed how the city of St. Paul regulates parking in five areas of the city (resident permits, visitor's permits and special permits), costs and qualifications. Madden is concerned that 16b6 Coffman residents are not being allowed to park on Coffman--University of Minnesota students are not Falcon Heights residents. He asked that the request be quickly acted upon. Discussion focused on whether visitor permits should be issued or whether resident permits should be issued or a combination of both, the precedent that will be set by allowing residents exclusive use of city streets and how such permits would be administered. Planner Malloy pointed out that in the November 5, 1984 Council Meeting Minutes John Uban, City Planner, pointed out that space is available should it ever be needed for added parking at the 1666 Coffman site. PRESENT ABSENT s/1 ~ 8/22 MINUTES APPROVED WILLIAM A. MADDEN, 1666 COFFMAN, PARKING REQUEST MALLOY A member of the University Grove Homeowner's Association advised that residents in that area will also be requesting resident parking permits soon similar to GROVE those issued by the city of St. Paul. ASSN. After further discussion, Duncan moved, seconded by Nestingen, to restrict MOTION FOR parking on Coffman from Larpenteur to Folwell to two hour parking from 8:00 A.M. 2 HR. to 4:00 P.M. weekdays and permits be issued for special events only. Upon a PARKING voice vote being taken, the following voted in favor thereof: Barry, Duncan FAILS and Nestingen, and the following voted against the same: Black, Carroll and Davkin. Motion failed. Discussion continued concerning the possibility of additional parking being available on the 1666 Coffman site, permit parking for residents vs. permit parking for visitors, inexpensive parking being available for Universit~~ students on Minnesota State Fair property anC how enfc~^~Pntwould be handled. MINUTES PLANNING COMMISSION MEETING SEPTEMBER 12, 1988 Planner Malloy pointed out that restricting student parking on Coffman will MALLOY migrate student parking to other areas. Daykin moved, seconded by Carroll, to allow twelve (12) parking permits on PARKING Coffman Street from Larpenteur to the 1666 Coffman Fire Lane for $xxxx PERMITS to be administered by City Staff for one (1) hour parking from 8:00 A.M. ON COFFMAN to 4:00 P.M. Monday thru Friday (except holidays and except by permit) for STREET a six month trial period. Upon a voice vote being taken, the following APPROVED voted in favor thereof: Barry, Nestingen, Black, Carroll, Daykin and the following voted against the same: Duncan. Motion carried. Nestingen moved, seconded by Daykin, a recommendation to the City Council REQUEST that the City authorize a proposal for a parking policy including permit FOR parking and parking in other cities. Motion carried unanimously. PARKING POLICY Planner Malloy then reviewed the Procedural Manual for the Planning Process and suggested the direction which should be followed for the development of PROCEDURE such manual. ~~~- C J Meeting adjourned at 10:20 P.M.AD30LTR~v':~IEN' Submitted by: Katherine J. Zimmerman APPROVED: October 3, 1988 Edgar Finegan, Secretary MINUTES HUMAN RIGHTS COMMISSION SEPTEMBER 15, 1988 PRESENT: Boger, Vavoulis, Talbot, Gibson-Talbot, Stenquist, Furton and Groff ABSENT: Lamb Wayne presented letter all Commissioners received regarding use of outside consultants. Commission advised that Tsippi Wray was contacted and that she was no longer interested in being on the Human Rights Commission. New members - Rick Talbot - started 7/88 (term expiration 12/90) Brian Stenquist - started 9/88 (term expiration 12/89) One position is still vacant but application has been received from G. James Olsen. All members present approved the application which will be sent to the City Council for approval. The 1988 Annual Meeting of the League of Minnesota Human Rights Commissions is scheduled for October 1, 1988. Seven members have submitted applications to attend. Liaison for Council Meeting - Jan and Rick will talk to Tom Baldwin. Boger will send her notes to them. The discussion ensued regarding the direction of the Human Rights Commission. The Commission felt it is necessary to develop a mission statement with specific goals. Stenquist will get copies of mission statements from other Commissions. Furton will talk to the Human Rights Department (EEO Department). Harvest States and Hewlett Packard. Talbot moved to table the discussion of the ordinances and to discuss the mission statement of the Commission. Furton seconded the motion and it was unanimously approved. Members then shared reasons why they became members of the Commission. Talbot moved to adjourn the meeting, seconded by Furton. Motion approved unanimously. Next meeting: October 20, 1988 at 7:30 P.M. X Consent I p°~y i CITY OF lALCON HEIGHTS tEQUEST !oA Cot1NCIL Agenda Item: E-5 Meeting D,te: 9/28/$8. ITEl1 DESCRIPTION: Licenses SUBMITTED BY: Shirley Chenoweth REVIE1iED BY: ~ EXPLANATION/SUI~SARY (attach additional sheets as neccs i ary): See attached list. i i I i i i i ACTION REQUESTED: i Approval ~ i I CONSENT AGENDA September 28, 1988 LICENSES GENERAL CONTRACTORS Home Modernizers Inc. ~~148 (New) 4153 Minnehaha Minneapolis, MN 55404 Solheim Builders 4165 (New) 4883 Sarafri Pass Eagan, MN 55122 Home Tailors ~~130 (New) 1463 Chelmsford Street St. Paul, MN 55108 Castle Building & Remodeling, Inc. ~~166 2125 East Hennepin Avenue Minneapolis, MN 55413 REFUSE HAULING Ballaire Sanitation, Inc. ~~152 2678 - 75th Street Stillwater, MN 55082 Metro Refuse, Inc. ~~167 8168 Ldest 125th Street, Savage, MN 55378 Conasnt '~ lolicy CITY OF l~ALCON HEIGHTS tEQUES? TOR COOI~ICIL Agenda Itcm: E-6 fleeting Date: 9/28/88 ITEM DE&CRIlTIOH: Ramsey County Sheriff's Report SU~IITTED EY: Sheriff's Department REVIEWED SY: Shirley G. Chenoweth i E7~LANATIOA/SVlHIARY (attach additional sDeets as nece i See attached. i t ACTION REQUESTED: i I ary}: OOr10.+.~00rIN00~000000000w1000000.+.+a~Or/p.y000N.d r .~ N A W Z.00 W WW V >6i W ZO W!f" J 2 O W V N OL J 1- N t9 OC.W O V W W Wd0 M QIt~ H = OiL V W<Oi O W W•O 00 OWN H y}.f N 1 f„1M Z NWZ H Oa[Z «OM\WWVt~N W i~l~ i4 WOM OLN ~ !V W « W N h N 1~ J W 1~ Q OC OC n t0 V OL d N W H M- NZY~NM dO <d /~W W O W V iL l./ !~ ZFtiO/-O C=~+1 ( 1 u =dG M oW WtY ZON OI~t S ~-« Q K ~[ s q, O[ W W N M~ F~ O H O i s s aL ! cs O uWG-~NiLIL~ ~1 ~~~Z= MStS S Ii.1 J WWO~D'~ .r1 W >~>`>~>`~ZHOWWW WAGON ~Wi.ital JC>~WdNiJ <JJ>rF~OLCO[OLOO<G=S= ~. J M~~fN1+LL1tiZZ W V W6 iS001~ N CZ7 tt/TZ~r Y<OVJZ~'IV J OVO<NtO~ftDU.1~1LILpp00000WJJOO r1 WOL=wIMOLONCCKCWWWWF`I'HNC<OC OG ZiO7tC~tTIILQ OJVV6-o[<FtN •COON''J~»Z1'S~»>OCOOC=Nl~m<WOIW«tLOCH«<Jti4i/.i1~JZZN1LV1LOCimOaD1~M~i- i«iY.ILWNN<>=GNZt~DOJOli<iiH«i -A A r1NPItNO1- OpO.~NA+Nd{.OO'Or1NA~lM1~O!-000r1yyAtO.aNUltrtO ~1r1 A~AA 000000000 NAAAN NNNNNNNNA1Adfl711r1NN>AHNrt1ln ~W i i I1f ~ ~ _..a ~ i 'w r OOOOn1r100~000r1(QOOOOOOOOf~000000N./~O~i~NOO~N1-F~C O ya Y dFEWZ OC F-j OO w WWW V YV W Z~ WYE O W O C H J Z .~. W {.~ VI OL J H N v Oi V !~I V W W W- O H O O[ -y = O 1L V W< .7 Z W ZNI~J !_« M~ 1 ( ~ < JZ ~ N=7 ~+ZYW O W W-•O 00 OWN « Y> J VN O Zi= N W WO N OCZHOII~WW VNN W /~M~ V Z WO« O[Irl .VIrO V W M W N 111 M N J W F~ O IL OC OL t8 N C O d N W -~V S M- NZI~NM GOOI <G I 1"~ W W Z O W V 1LlJ 1~ =1~tZ v i W01-O OC=« t ( 1 u Zdc. Owec ZGH OI+i Z -~.+OC«OK etZ«C W WNM~1~1~ WOOHVO < sY /L>E VOV r 1~ 1L~i OJM .W SJ W t 111WOM~NIL IL IV ~/ to[oCZt ZW >> >• Y! Z N Q W W W W` d O V1 O W V O 1 JOC Y WGNi,I iJ J >` 1~ fY OI oL C O O< ~. S Z Z Y J « w of /~ 1L « Z W t~ W V Z O of F N Z O iN NW»HONOF-DOJZ-~OaC~QGGI~tb iV WWV JJJ ZWWl~i~VOiclNOJtiLL1~ 1L000OtlOW JJOOd N VOW?70OL 1 { { Wd!-y OL J OLONCOL OCY W W WWI~~HNOC<00 OCZ <O~[OCZu.r~ONtsJl~tiV~Ci«H 0t N O OrSLJ0ttiVI LOCiOrHHM~~!«<~{LWV1N<>7dNZi00 NNIA ANe1t~ NOl~ aa00.~N1~1• •f~0?O.rNenl~e'~~Of-OpO.rNA10.~NMt~1f0 '~000000000.rr~~~lA~r~.~.~1.~NNNNNNNNNNAN/w1AA+e~gN~IUU-Yf!111 -sp0000000pR/000000000 00000QO000N~~ lOO~fNO000t11 nl _ .~1r1 tMl rf e~i WWW V V ~. W - ZO~ W?~W O K 1~ J Z O W V N OI J t i~ N V dl ~V W W WGO H mC = OtL: W<O O WWO 00 OWH -~ f~l~ J YMQ ZiZ NW N OOC=«O~l1WWVFN W i~~M WOM CIV M~W ~I W N Y1 M F~ J W !~ O Y. C OC CO tI OL ~ ~ {L - N W M S G HZZi~ NN GrOCSG ~ FWWY O W V t`>r.~/ F. SM.u t< WO1~O Cl~+( 1 ! u ZGG OWOI ZON O1~< = 1~~I oc acZ<datWWN/. p.Fwoo «vo <s7•s ocs v ou W 1 { / 1WOh~NIV Y. 1i ~ V tOL OCZ= 2 i~OiJ OLWOJH v Gd O w W J J i 0 JJYNOLO[pL00i0Z== >r JN tLwZ tO WVZOKF N Z O a0ac~ii« 1 i 1 11-M-1- et wtZZ~J -ru.t~-~NZ4[~~O«iLW=<N HI«W JJJJ1~1~-+F•, ZWON WWidi~M~00JZ« `uVO<ONtlNLL~ L~L~i0000ilOWJJ~06M VOWl7Qet11 / WotZ«+ ~ .J OLeDNOLdIOLOLWWWWHFF~.I1aL<OOOOZ<OxoC=IL«ONtfJtuVd«aNLOON7»>SSSS'J' »aLOOL= h-1-~OiW1LW<iWatM.t<J6~ViJ1~J N1LVt<OC <000OFY4. 1••««~L 1-W NN<!=GNZ HOOJ O!«i<N<1 AN~1N~p1~a00~O~ NMtN.O(+OPO.rN~+IiO~Of~/p0'OANAI.tO~N~+I~-t~~0eni000000000.~.r.IN.~.~.i.•1.~.iNNNNNNNNNNIgMIAIAIMl~11iNNMY~Nif1t ._J1i ~ J ) ) ~. J ~ l ) 1 i• 00.~NNOa••..+oenooowo N. N N ~ w r1 W r N Y S Y Y n. W i r ti = i Z H t H ~ J N WN JA = N 2 a F" ! o M F- O O! O N i s i OC z N Ot s u ~ V NW H ~ C.NN yO{~~ W ~O~ J Y d O~J~ Z ~ s ~ duu Wawa s u s ! «. z u nc .c m .+ u J z zx o.-~~yy zWWSOw~+J V 1~i• • WCL W N OOL=0WV t' J <W<mia=WOC~N~I.i<ON<NF~OOL0000lHOrnACWWZ~KH O li. mm OO~ OW 4.JldOCNNNr! F•e1ih o 0 0 .~ N R) • 1!- e w O O~ O r1 N 1M1 i+s mr+ r,eeeeooeeeewwww i ~ Fi OOOr/riOM1d~INONOO~ MM mrlN N IN w Z o~ a o h ur u > ..i w JNN z Lr =i N U N 4~NO NW HOLwN < W N W N W N W Y J Y L O<J~ Z WJ t V U W Zr1 O ca< l.,z ca ac ac mr.uJ H N V r~JiVlMIiW N1•NNV Jyu rt• WatWON iO~C~`~iU i JiWsml/i' W~ONO{i<ONtN F-N N O W iILILJI~MN NH!gNOO M~Aw 0 0~ .~ N N/ .- IR I+ r O~ O .~ N In w e~eee elewtiww n 00.0.-It~ IttON~-rOOrt-~10N !'~1O H C!~j 1 6 m Y r i Z 1.. i i N N Zdlr =r w r O 02 O N U A N W ~ ! ` ~ C N O r1 N i W Y W H W W Y ../ Y ~ g s d O Z J dfJi./ W=- rO Z S Or W Z W W T OCi MJ y~NHUN~C ~+ Jiut-~1LWV i• • WOL WOH COOL=G1LN J i Wim V' =W ~OVIOV i OVIiN r Oo00000=~-+0•+niWWZ~ aLw OLm m 0000 W 1L J L doL Vf HN H=r M N ~O~ O.rNN1i11O~cD0~ O~Nr1n none o r o e n r. ~... ,~1 i i j 1 , ~ I i 7 i i f i i 1 i ~ 1 i e Consent a Policy CITY OF FALCON HEIGSTS AEQUE8T FOR COUNCIL CON810 J r~ Meeting Date:9/28/8. Agenda Itea: E-7 ITEM DESCRIPTION: Appointment of Plumbing inspeetor position for the City SUBMITTED BY: Al Rolek REVIEWED BY: Al Rolek ~ Jan.Wiessner E$PLANATION/SU1~Il~IARY (attach additional sheets as n essary}: In late June of th3.s year, our Plumbing inspector Dick Alquist, passed away. Since that time, Gene Pakoy has been filling in a interim inspector. We received 3 applications for this position. I hav met. and spoken with all 3 applicants. Based on these meetings, I believe that of the applicants, Bi11 Walsh would be the most appropriate choice ecause of his availability and experience (Bill is the. Plumbing inspector fo the Cities of Shoreview & Arden Hills). I have talked to both cities and have found that ill Walsh is doing a respectable fob for them and they have no complai t with his performance. RECOMliENDATION: Appoint Bill Walsh City`Plumbing I spector with remuneration at 80y of permit fees. i~ opplicntron for ~m{~lo~m~nt We are an equal opportunity employer: dedicated to a policy of non-discrimination in employment on any basis including race. color, age, sex, religion or national origin. 5 /~~ PERSONAL INFORMATION D t soaal Security y~©_ 3 y ~OSDNumberae l rtName ~)Ws l Z G1I E~ "85t First Mddle Present Address ~p ~~ ~r (J/ t'G R `,Zr J /~O /~e V~ C 'V~ ~~{ r' R17. .s J ~~ (~ Street City State Zip Permanent Address S tl,~/77 °~State ZipGtStrcety G / Phone No ~p p~ ' ~~ (O Referred ~ By /077 C1~ OG~! l S~eneV eW, ~~c, ~'nsPecto!' ~ EMPLOYMENT DESIRED Position ~ ~ e G~D!' Date You Salary p ~G')'Can Start , Desired v D o ~ P Y t~ ~° S S ~? ~~~ / ~Are You Em to ed Ncw? ~ /n p 0 IY~° If So May We Inquire ~ ~ ./.~ { Q' I , / IS /1 ~,I ~ ~f't~of Your Present Employer . q ~ f ! ~ WQ Ever Applied tc this Company Before % (-/~Where When EDUCATION u n Circle Did You Subjects Studied and Name and Location of School Last Year Graduate? Degree(s) Received Compketed r~iYes Grammar School 5 No e ~ S'1 2 3 ~LP'S'es f~/ f1 Sc/~fOp/~qye High School No 1 2 3 4 Yes College No Trade. Business or S'! Pq / e/~s hDJ1.~l~~1 2 3 IY{es i~trOKPRey1114/I ~ Correspondence 7 T No Haste/' ~/~c!School S G Subjects of Special Study or Research .Work P Activities Othe• Thai Religious Civic. Athletic. etc l~ EXCLUDE URGA4:'A'~O`:S THE NAME OR ChARACTER OF WHICH INDICATES THE RACE. AGE SEX. COLOR OR NATIONAL ORfGIN OF ITS MEMBERS Form M660-26NR PnMed rn U.~ A (t'.Ontlnued On Othef Slde) APPUCATIOGJ FOR EMPLOYMENT c 19g5 WIISOn JateS Company FORMER EMPLOYERS List Below Last Four Employers, Starting With Last One First Date Month and Year Name and Address of Employer Salary Position Reason for Leavin g From To S!? ~fp~7?/ /~Ye~ ~~ y/'s9'S7Fe /' e/- From o y~s To 6 /~ ~% ~ndn E From To From To REFERENCES: Give Below the Names of Three Persons Not Related To You, Whom You Have Known At Least One Year. Name Address Business Years Acquainted N r i p P~ sTPQ,~ C s- s 2 / i o P~ !r G S ~ ~P S r , p3 /to~Jer~ ~~~a 9C;~n / ~+;o~~ot~ lV. (.JWaS~.r'o Q~ir i0c~(c:D S PHYSICAL Do you have any physical condition which may limit This question is voluntary, and any answers will be RECORD: Your ability to perform the job applied for? AIB kept confidentiat. In Case of ~~ j / ,Emergency Notify /IlllJ~./~nG ~/ 4 IS~J /o~~ S ~,j''~rt1 6/7 7~0`~ ~~G,~Name Address Phone No. I authorize investigation of all statements contained in this application. I understand that misrepresentation or omission of facts called for is cause for dismissal.Further, I understand and agree that my employment is for no definite period and may, regardless of the date of payment of my wagesand salary, be terminated atanytimewithoutanypreviousnotice. Date ~'~ S ~~ DO NOT WRITE BELOW THIS LINE Interviewed REMARKS: Neatness Date SalaryHiredForDept. Position Will Rept~^ Wages Approved: 1 2 Employment Manager Dept. Head General Manager